Heterocephalus glaber (naked mole-rat): 101696772 Help Entry 101696772         CDS       T02812                                  Symbol Gng4 Name (RefSeq) G protein subunit gamma 4   KO K04541   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04014   Ras signaling pathway hgl04062   Chemokine signaling pathway hgl04081   Hormone signaling hgl04082   Neuroactive ligand signaling hgl04151   PI3K-Akt signaling pathway hgl04371   Apelin signaling pathway hgl04713   Circadian entrainment hgl04723   Retrograde endocannabinoid signaling hgl04724   Glutamatergic synapse hgl04725   Cholinergic synapse hgl04726   Serotonergic synapse hgl04727   GABAergic synapse hgl04728   Dopaminergic synapse hgl04926   Relaxin signaling pathway hgl05032   Morphine addiction hgl05034   Alcoholism hgl05163   Human cytomegalovirus infection hgl05167   Kaposi sarcoma-associated herpesvirus infection hgl05170   Human immunodeficiency virus 1 infection hgl05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     101696772 (Gng4)    04371 Apelin signaling pathway     101696772 (Gng4)    04151 PI3K-Akt signaling pathway     101696772 (Gng4)   09133 Signaling molecules and interaction    04082 Neuroactive ligand signaling     101696772 (Gng4)    04081 Hormone signaling     101696772 (Gng4)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     101696772 (Gng4)   09152 Endocrine system    04926 Relaxin signaling pathway     101696772 (Gng4)   09156 Nervous system    04724 Glutamatergic synapse     101696772 (Gng4)    04727 GABAergic synapse     101696772 (Gng4)    04725 Cholinergic synapse     101696772 (Gng4)    04728 Dopaminergic synapse     101696772 (Gng4)    04726 Serotonergic synapse     101696772 (Gng4)    04723 Retrograde endocannabinoid signaling     101696772 (Gng4)   09159 Environmental adaptation    04713 Circadian entrainment     101696772 (Gng4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101696772 (Gng4)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101696772 (Gng4)    05163 Human cytomegalovirus infection     101696772 (Gng4)    05167 Kaposi sarcoma-associated herpesvirus infection     101696772 (Gng4)   09165 Substance dependence    05032 Morphine addiction     101696772 (Gng4)    05034 Alcoholism     101696772 (Gng4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:hgl04031]     101696772 (Gng4) GTP-binding proteins [BR:hgl04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     101696772 (Gng4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-gamma Adeno_PV Motif Other DBs NCBI-GeneID:  101696772 NCBI-ProteinID:  XP_004854677 UniProt:  G5BTJ6 LinkDB All DBs Position Un AA seq 75 aa AA seqDB search MKESMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPA SENPFREKKFFCTIL NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgaaagagagcatgtccaataacagtaccactagcatctcccaggcccggaaggctgtg gagcagctgaagatggaggcctgcatggacagggtgaaggtgtcccaggcagcggcagac ctcctggcatactgcgaagcccatgtgcgggaggaccccctcatcatcccagtgcctgca tcagagaaccccttccgggagaagaagttcttctgcaccatcctctga

DBGET integrated database retrieval system