Heterocephalus glaber (naked mole-rat): 101698389 Help Entry 101698389         CDS       T02812                                  Symbol Tmem258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl00510   N-Glycan biosynthesis hgl00513   Various types of N-glycan biosynthesis hgl04141   Protein processing in endoplasmic reticulum Module hgl_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:hgl00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     101698389 (Tmem258)    00513 Various types of N-glycan biosynthesis     101698389 (Tmem258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101698389 (Tmem258) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  101698389 NCBI-ProteinID:  XP_004874357 UniProt:  A0AAX6QHI5 LinkDB All DBs Position Un AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctcgaggccatgagcagatacaccagccctgtgaacccagctgtcttcccccat ctgactgtggtgctcctggccattggcatgttcttcactgcctggttcttcgtctacgag gtcacctccaccaagtacacgagggacatctacaaagagctcctcatctcgctggtggcc tcgctcttcatgggctttggcgtcctcttcctgctgctctgggttggcatctacgtatga

DBGET integrated database retrieval system