Heterocephalus glaber (naked mole-rat): 101699042 Help Entry 101699042         CDS       T02812                                  Symbol Ifnb1 Name (RefSeq) interferon beta 1   KO K05415   interferon beta Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04060   Cytokine-cytokine receptor interaction hgl04151   PI3K-Akt signaling pathway hgl04217   Necroptosis hgl04380   Osteoclast differentiation hgl04620   Toll-like receptor signaling pathway hgl04621   NOD-like receptor signaling pathway hgl04622   RIG-I-like receptor signaling pathway hgl04623   Cytosolic DNA-sensing pathway hgl04630   JAK-STAT signaling pathway hgl04650   Natural killer cell mediated cytotoxicity hgl04668   TNF signaling pathway hgl04936   Alcoholic liver disease hgl05135   Yersinia infection hgl05142   Chagas disease hgl05152   Tuberculosis hgl05160   Hepatitis C hgl05161   Hepatitis B hgl05162   Measles hgl05163   Human cytomegalovirus infection hgl05164   Influenza A hgl05165   Human papillomavirus infection hgl05167   Kaposi sarcoma-associated herpesvirus infection hgl05168   Herpes simplex virus 1 infection hgl05169   Epstein-Barr virus infection hgl05170   Human immunodeficiency virus 1 infection hgl05171   Coronavirus disease - COVID-19 hgl05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101699042 (Ifnb1)    04668 TNF signaling pathway     101699042 (Ifnb1)    04151 PI3K-Akt signaling pathway     101699042 (Ifnb1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101699042 (Ifnb1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101699042 (Ifnb1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101699042 (Ifnb1)    04621 NOD-like receptor signaling pathway     101699042 (Ifnb1)    04622 RIG-I-like receptor signaling pathway     101699042 (Ifnb1)    04623 Cytosolic DNA-sensing pathway     101699042 (Ifnb1)    04650 Natural killer cell mediated cytotoxicity     101699042 (Ifnb1)   09158 Development and regeneration    04380 Osteoclast differentiation     101699042 (Ifnb1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101699042 (Ifnb1)    05161 Hepatitis B     101699042 (Ifnb1)    05160 Hepatitis C     101699042 (Ifnb1)    05171 Coronavirus disease - COVID-19     101699042 (Ifnb1)    05164 Influenza A     101699042 (Ifnb1)    05162 Measles     101699042 (Ifnb1)    05168 Herpes simplex virus 1 infection     101699042 (Ifnb1)    05163 Human cytomegalovirus infection     101699042 (Ifnb1)    05167 Kaposi sarcoma-associated herpesvirus infection     101699042 (Ifnb1)    05169 Epstein-Barr virus infection     101699042 (Ifnb1)    05165 Human papillomavirus infection     101699042 (Ifnb1)   09171 Infectious disease: bacterial    05135 Yersinia infection     101699042 (Ifnb1)    05152 Tuberculosis     101699042 (Ifnb1)   09174 Infectious disease: parasitic    05142 Chagas disease     101699042 (Ifnb1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101699042 (Ifnb1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101699042 (Ifnb1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101699042 (Ifnb1) Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Interferons    101699042 (Ifnb1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon DUF2779 SesA NYD-SP28 Motif Other DBs NCBI-GeneID:  101699042 NCBI-ProteinID:  XP_004838404 UniProt:  G5CB66 LinkDB All DBs Position Un AA seq 187 aa AA seqDB search MANRCILQIALLLSFSTISLSLSYKLLQAQQRSSSLACGELLKQLKGKPEYCLKDRMDFK FPEEIKQPQHFRKENAALVIQEMLQNILDIVRKNFSNTVWNETIVENLLVELHQQMDSLK TLLQEILEKKDITWEDTMIIPRLKGYYWRIRRHMKAKDNSICAWTVVQVELSRNFSFINR LTDYFQD NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atggccaacaggtgtatcctccaaatcgctctcctgttgtccttctctaccatatctctt tccttaagctacaaattgcttcaagcccaacaacgcagcagcagtttggcctgtggggag cttttgaagcagttgaaaggaaaacctgaatattgcctcaaggacaggatggatttcaaa ttccctgaggagatcaagcaaccacagcacttccggaaggagaatgctgctcttgtcatc caggagatgctccagaatatcttggatattgtcagaaaaaatttctctaacactgtatgg aatgagaccattgttgagaacctccttgttgaactccatcagcagatggacagtctgaag acactcctgcaggaaatactggagaagaaggacattacctgggaggacaccatgatcatt ccacgcctgaaggggtattattggaggatcaggaggcacatgaaggccaaggacaacagc atttgtgcctggacagtagtccaggtagaactctccaggaacttttccttcattaacaga cttacagattatttccaagactga

DBGET integrated database retrieval system