Heterocephalus glaber (naked mole-rat): 101699716 Help Entry 101699716         CDS       T02812                                  Symbol Cd28 Name (RefSeq) CD28 molecule   KO K06470   CD28 antigen Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04514   Cell adhesion molecules hgl04660   T cell receptor signaling pathway hgl04672   Intestinal immune network for IgA production hgl04940   Type I diabetes mellitus hgl05162   Measles hgl05235   PD-L1 expression and PD-1 checkpoint pathway in cancer hgl05320   Autoimmune thyroid disease hgl05322   Systemic lupus erythematosus hgl05323   Rheumatoid arthritis hgl05330   Allograft rejection hgl05332   Graft-versus-host disease hgl05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     101699716 (Cd28)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     101699716 (Cd28)    04672 Intestinal immune network for IgA production     101699716 (Cd28)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101699716 (Cd28)   09172 Infectious disease: viral    05162 Measles     101699716 (Cd28)   09163 Immune disease    05322 Systemic lupus erythematosus     101699716 (Cd28)    05323 Rheumatoid arthritis     101699716 (Cd28)    05320 Autoimmune thyroid disease     101699716 (Cd28)    05330 Allograft rejection     101699716 (Cd28)    05332 Graft-versus-host disease     101699716 (Cd28)   09166 Cardiovascular disease    05416 Viral myocarditis     101699716 (Cd28)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     101699716 (Cd28)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04515 Cell adhesion molecules [BR:hgl04515]     101699716 (Cd28)    04090 CD molecules [BR:hgl04090]     101699716 (Cd28) Cell adhesion molecules [BR:hgl04515]  Immunoglobulin superfamily   Other    101699716 (Cd28) CD molecules [BR:hgl04090]  Proteins   101699716 (Cd28) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  V-set_2 V-set DUF2852 DUF2681 Motif Other DBs NCBI-GeneID:  101699716 NCBI-ProteinID:  XP_004851403 UniProt:  A0AAX6PG36 LinkDB All DBs Position Un AA seq 211 aa AA seqDB search MDEENMEYENKILVKQSPMLVVYDNEVNLSCKYTYNLFSKEFRASLYKGVDSAVEVCVVN GNFSHPLQFHSNTGFNCDGNLDNETVTFYLRNLFVNQTDIYFCKIEVMYPPPYLDEKSNG TIIHVIERHHPHPCVRLCPESKPFWTVVVVGGVVAFYSVVVTMAFYLYWIKSKRTRLLQS DYMNMTPRRLGPTRRHYQPYAPARDFAAYRS NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggatgaagagaatatggaatatgaaaacaagatattggtgaagcagtcacccatgctt gtggtgtatgacaatgaggtcaaccttagctgcaagtacacctacaaccttttctcaaag gagttccgggcatccctgtacaagggtgtggatagcgctgtggaagtctgtgtcgtgaat gggaatttctcccatccacttcagtttcactcaaatacagggttcaactgtgatgggaat ttggacaacgaaacagtgactttctacctccggaatttgttcgttaaccaaacagatatt tacttctgcaaaattgaggtcatgtatcctcctccttacctagatgagaagagcaatgga accattatccatgtgatagagaggcaccatccgcatccttgtgttcgcctgtgtcctgaa tctaagcccttttggacagtggtagtggttggaggagtcgtggctttctatagtgtggta gtaacaatggccttttatttgtattggataaagagcaaaaggaccaggctccttcagagt gactacatgaacatgactccccggaggcttgggcccacccgcaggcactaccagccctac gccccagcaagagactttgccgcctaccgctcctga

DBGET integrated database retrieval system