Heterocephalus glaber (naked mole-rat): 101700634 Help Entry 101700634         CDS       T02812                                  Name (RefSeq) CD209 antigen-like protein E   KO K06563   C-type lectin domain family 4 member L/M Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl03260   Virion - Human immunodeficiency virus hgl03264   Virion - Flavivirus and Alphavirus hgl03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus hgl03273   Virion - Lassa virus and SFTS virus hgl04145   Phagosome hgl04625   C-type lectin receptor signaling pathway hgl05152   Tuberculosis hgl05162   Measles Brite KEGG Orthology (KO) [BR:hgl00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     101700634    03264 Virion - Flavivirus and Alphavirus     101700634    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     101700634    03273 Virion - Lassa virus and SFTS virus     101700634  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     101700634  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101700634  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     101700634   09171 Infectious disease: bacterial    05152 Tuberculosis     101700634  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hgl04131]     101700634   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:hgl04054]     101700634    04515 Cell adhesion molecules [BR:hgl04515]     101700634    04090 CD molecules [BR:hgl04090]     101700634    04091 Lectins [BR:hgl04091]     101700634 Membrane trafficking [BR:hgl04131]  Endocytosis   Phagocytosis    C-lectin receptors     101700634 Pattern recognition receptors [BR:hgl04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    101700634 Cell adhesion molecules [BR:hgl04515]  Lectins   Selectins and C-type lectins    101700634 CD molecules [BR:hgl04090]  Proteins   101700634 Lectins [BR:hgl04091]  C-Type lectins   Asialoglycoprotein and DC receptors    101700634 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C Tetraspanin Motif Other DBs NCBI-GeneID:  101700634 NCBI-ProteinID:  XP_004866099 LinkDB All DBs Position Un AA seq 203 aa AA seqDB search MALRLFCTTFFNLNALILQIGSPWSVTGCQKLAWCQDKGLISLVLQLLALILFAGLLVAI LAQVSKVPSSEERKKEKSNQEKMYQELNQLKTGFDCLCRPCPWDWTFFQRKCYFFSRSQR DWRDSITTCQEVGAQLVIVENAEEQSFLQQTSKSKGYAWMGLSDLNKESEWHWVDGSPLS LSLVRYWNKGQPNNYEEQDCVEF NT seq 612 nt NT seq  +upstreamnt  +downstreamnt atggctctgagactcttctgtaccacgttcttcaacctcaatgcactcatcctgcagatt ggaagtccctggtcagtcactggctgccagaagttggcatggtgtcaggacaaaggtctc atctccctggtcctgcagctgcttgccctcattctcttcgctgggctcctggtggccatc cttgcccaagtctccaaggtccccagcagtgaggagaggaagaaggagaagtcaaaccag gagaaaatgtatcaggaactgaaccagctgaagactggatttgactgtctgtgccgtccc tgcccctgggactggacattcttccaaagaaagtgctacttcttctccaggtcccaacgg gactggcgtgactccatcaccacttgccaggaagtgggggctcaactcgtcattgtggaa aatgctgaagagcagagcttcctgcagcagacttcgaagagtaaaggctacgcctggatg ggactctcagacctgaacaaggaatccgagtggcactgggtggatggttcacctctgtcg ctcagccttgttcggtactggaacaaagggcagcccaacaactatgaggaacaagactgt gtggaattttga

DBGET integrated database retrieval system