Heterocephalus glaber (naked mole-rat): 101702602 Help Entry 101702602         CDS       T02812                                  Symbol Il6 Name (RefSeq) interleukin 6   KO K05405   interleukin 6 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl01521   EGFR tyrosine kinase inhibitor resistance hgl01523   Antifolate resistance hgl04060   Cytokine-cytokine receptor interaction hgl04061   Viral protein interaction with cytokine and cytokine receptor hgl04066   HIF-1 signaling pathway hgl04068   FoxO signaling pathway hgl04151   PI3K-Akt signaling pathway hgl04218   Cellular senescence hgl04620   Toll-like receptor signaling pathway hgl04621   NOD-like receptor signaling pathway hgl04623   Cytosolic DNA-sensing pathway hgl04625   C-type lectin receptor signaling pathway hgl04630   JAK-STAT signaling pathway hgl04640   Hematopoietic cell lineage hgl04657   IL-17 signaling pathway hgl04659   Th17 cell differentiation hgl04668   TNF signaling pathway hgl04672   Intestinal immune network for IgA production hgl04931   Insulin resistance hgl04932   Non-alcoholic fatty liver disease hgl04933   AGE-RAGE signaling pathway in diabetic complications hgl04936   Alcoholic liver disease hgl05010   Alzheimer disease hgl05020   Prion disease hgl05022   Pathways of neurodegeneration - multiple diseases hgl05132   Salmonella infection hgl05133   Pertussis hgl05134   Legionellosis hgl05135   Yersinia infection hgl05142   Chagas disease hgl05143   African trypanosomiasis hgl05144   Malaria hgl05146   Amoebiasis hgl05152   Tuberculosis hgl05161   Hepatitis B hgl05162   Measles hgl05163   Human cytomegalovirus infection hgl05164   Influenza A hgl05166   Human T-cell leukemia virus 1 infection hgl05167   Kaposi sarcoma-associated herpesvirus infection hgl05168   Herpes simplex virus 1 infection hgl05169   Epstein-Barr virus infection hgl05171   Coronavirus disease - COVID-19 hgl05200   Pathways in cancer hgl05202   Transcriptional misregulation in cancer hgl05321   Inflammatory bowel disease hgl05323   Rheumatoid arthritis hgl05332   Graft-versus-host disease hgl05410   Hypertrophic cardiomyopathy hgl05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101702602 (Il6)    04668 TNF signaling pathway     101702602 (Il6)    04066 HIF-1 signaling pathway     101702602 (Il6)    04068 FoxO signaling pathway     101702602 (Il6)    04151 PI3K-Akt signaling pathway     101702602 (Il6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101702602 (Il6)    04061 Viral protein interaction with cytokine and cytokine receptor     101702602 (Il6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     101702602 (Il6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     101702602 (Il6)    04620 Toll-like receptor signaling pathway     101702602 (Il6)    04621 NOD-like receptor signaling pathway     101702602 (Il6)    04623 Cytosolic DNA-sensing pathway     101702602 (Il6)    04625 C-type lectin receptor signaling pathway     101702602 (Il6)    04659 Th17 cell differentiation     101702602 (Il6)    04657 IL-17 signaling pathway     101702602 (Il6)    04672 Intestinal immune network for IgA production     101702602 (Il6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101702602 (Il6)    05202 Transcriptional misregulation in cancer     101702602 (Il6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101702602 (Il6)    05161 Hepatitis B     101702602 (Il6)    05171 Coronavirus disease - COVID-19     101702602 (Il6)    05164 Influenza A     101702602 (Il6)    05162 Measles     101702602 (Il6)    05168 Herpes simplex virus 1 infection     101702602 (Il6)    05163 Human cytomegalovirus infection     101702602 (Il6)    05167 Kaposi sarcoma-associated herpesvirus infection     101702602 (Il6)    05169 Epstein-Barr virus infection     101702602 (Il6)   09171 Infectious disease: bacterial    05132 Salmonella infection     101702602 (Il6)    05135 Yersinia infection     101702602 (Il6)    05133 Pertussis     101702602 (Il6)    05134 Legionellosis     101702602 (Il6)    05152 Tuberculosis     101702602 (Il6)   09174 Infectious disease: parasitic    05146 Amoebiasis     101702602 (Il6)    05144 Malaria     101702602 (Il6)    05142 Chagas disease     101702602 (Il6)    05143 African trypanosomiasis     101702602 (Il6)   09163 Immune disease    05323 Rheumatoid arthritis     101702602 (Il6)    05321 Inflammatory bowel disease     101702602 (Il6)    05332 Graft-versus-host disease     101702602 (Il6)   09164 Neurodegenerative disease    05010 Alzheimer disease     101702602 (Il6)    05020 Prion disease     101702602 (Il6)    05022 Pathways of neurodegeneration - multiple diseases     101702602 (Il6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101702602 (Il6)    05410 Hypertrophic cardiomyopathy     101702602 (Il6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101702602 (Il6)    04932 Non-alcoholic fatty liver disease     101702602 (Il6)    04931 Insulin resistance     101702602 (Il6)    04933 AGE-RAGE signaling pathway in diabetic complications     101702602 (Il6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     101702602 (Il6)    01523 Antifolate resistance     101702602 (Il6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101702602 (Il6) Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Interleukins    101702602 (Il6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL6 IL23 Motif Other DBs NCBI-GeneID:  101702602 NCBI-ProteinID:  XP_004839876 UniProt:  G5BB49 LinkDB All DBs Position Un AA seq 253 aa AA seqDB search MVLLPCEGGVWLSEGWRLASSNSRLTAVLSAHWLLSLPFGTGTFRPLALWGLLLVTVTAA PTSQVLKDFRADTTSSKPTTSNSQAFRLFTLVLHDVQELKSETCKHNVNCLEEEKAMLNN LNLPKIKIEDGCFYGGYNWETCHLKIITGLLKFQIYLQYMQNKLQSDSENEKAEKIYTSV KSLSLFMKAKVSNTEQTVFPSPTANATLLEELESQNETQKLLIVQIVLCSLEEFLQNSLR PIRKAGSDLDLDI NT seq 762 nt NT seq  +upstreamnt  +downstreamnt atggtgctcctcccttgtgagggaggtgtgtggctgagtgagggctggcgtctggccagc tccaacagcaggctcacagctgtgctgtcagctcactggctgctctcccttcccttcggc acaggcaccttccgtccacttgccttgtgggggctgctcctggtaacagttactgctgct cccacctcacaagttctgaaagatttcagggctgatacgacgtcaagtaagccaacaacc tctaattcacaagcgtttcgactgtttacgctagtcctccacgatgtccaggaactgaaa agtgagacgtgcaaacataatgtcaattgcctagaggaggaaaaggcaatgttaaacaac ctgaacctcccaaagataaaaatagaagatggatgcttctacggtggatacaactgggaa acatgccacttgaaaatcatcactggtcttctgaagttccagatctacctgcagtacatg cagaacaagcttcagagtgactctgaaaatgaaaaagctgaaaaaatatacactagtgtc aaaagcttgagtctgttcatgaaagctaaggtaagcaatacagaacagacagtcttccct agcccaactgcgaatgccaccctgctggaggagctggagtcacagaatgagactcagaag cttttgatagttcaaatcgttctgtgcagccttgaagaattcctgcagaatagtctgagg cctattcggaaagcaggttcagacttggacttagatatctaa

DBGET integrated database retrieval system