Heterocephalus glaber (naked mole-rat): 101702804 Help Entry 101702804         CDS       T02812                                  Symbol Il18 Name (RefSeq) interleukin 18   KO K05482   interleukin 18 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04060   Cytokine-cytokine receptor interaction hgl04061   Viral protein interaction with cytokine and cytokine receptor hgl04621   NOD-like receptor signaling pathway hgl04623   Cytosolic DNA-sensing pathway hgl05132   Salmonella infection hgl05134   Legionellosis hgl05135   Yersinia infection hgl05143   African trypanosomiasis hgl05144   Malaria hgl05152   Tuberculosis hgl05164   Influenza A hgl05321   Inflammatory bowel disease hgl05323   Rheumatoid arthritis hgl05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101702804 (Il18)    04061 Viral protein interaction with cytokine and cytokine receptor     101702804 (Il18)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     101702804 (Il18)    04623 Cytosolic DNA-sensing pathway     101702804 (Il18)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     101702804 (Il18)   09171 Infectious disease: bacterial    05132 Salmonella infection     101702804 (Il18)    05135 Yersinia infection     101702804 (Il18)    05134 Legionellosis     101702804 (Il18)    05152 Tuberculosis     101702804 (Il18)   09174 Infectious disease: parasitic    05144 Malaria     101702804 (Il18)    05143 African trypanosomiasis     101702804 (Il18)   09163 Immune disease    05323 Rheumatoid arthritis     101702804 (Il18)    05321 Inflammatory bowel disease     101702804 (Il18)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101702804 (Il18)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101702804 (Il18) Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Interleukins    101702804 (Il18) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 Motif Other DBs NCBI-GeneID:  101702804 NCBI-ProteinID:  XP_004856637 UniProt:  A0AAX6PQ53 LinkDB All DBs Position Un AA seq 195 aa AA seqDB search MMMAVSVSENDCINFVEMKFIDNILYFIPENDENLESDYFGKLVPKLSVIRNLKNQVLIV DREKKPVFEDMPDADIADNAPQTTFNKYTYTDSRGRGMAIVISVMCNGNHTLSCEDKTIS FKEINPPDNIVDTKSDIIFFQRRVPGHDDKMQFESSLYEGYFLACQKEKDFYKLILKKKD ESGDKSIMFTVQNKD NT seq 588 nt NT seq  +upstreamnt  +downstreamnt atgatgatggctgtttctgtctcagaaaatgattgcatcaactttgtggaaatgaaattt attgacaatatactttactttatacctgaaaatgatgaaaacctggaatcagattacttt ggcaaacttgtacctaaattgtcagtcatacgaaatttgaaaaaccaagtcctcattgtc gaccgtgagaagaaacctgtgtttgaggatatgcctgatgctgacattgcagataatgca cctcagactacatttaacaaatatacatataccgatagccgtggtagaggtatggctata gtcatctctgtgatgtgtaacggaaaccatactctctcctgtgaggacaaaaccatttcc tttaaggaaatcaatcctcctgataatatcgttgacacaaaaagtgacatcatattcttt cagagacgtgttccaggacatgatgataagatgcaatttgagtcttcattgtatgaagga tactttctagcttgtcaaaaagagaaagacttttacaaacttattttgaaaaaaaaggat gaatctggggataaatctataatgttcactgtccaaaacaaagactag

DBGET integrated database retrieval system