Heterocephalus glaber (naked mole-rat): 101705558 Help Entry 101705558         CDS       T02812                                  Symbol Cxcl1 Name (RefSeq) growth-regulated alpha protein   KO K05505   C-X-C motif chemokine 1/2/3 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04060   Cytokine-cytokine receptor interaction hgl04061   Viral protein interaction with cytokine and cytokine receptor hgl04062   Chemokine signaling pathway hgl04064   NF-kappa B signaling pathway hgl04621   NOD-like receptor signaling pathway hgl04657   IL-17 signaling pathway hgl04668   TNF signaling pathway hgl04936   Alcoholic liver disease hgl05134   Legionellosis hgl05146   Amoebiasis hgl05167   Kaposi sarcoma-associated herpesvirus infection hgl05323   Rheumatoid arthritis hgl05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     101705558 (Cxcl1)    04668 TNF signaling pathway     101705558 (Cxcl1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101705558 (Cxcl1)    04061 Viral protein interaction with cytokine and cytokine receptor     101705558 (Cxcl1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     101705558 (Cxcl1)    04657 IL-17 signaling pathway     101705558 (Cxcl1)    04062 Chemokine signaling pathway     101705558 (Cxcl1)  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     101705558 (Cxcl1)   09171 Infectious disease: bacterial    05134 Legionellosis     101705558 (Cxcl1)   09174 Infectious disease: parasitic    05146 Amoebiasis     101705558 (Cxcl1)   09163 Immune disease    05323 Rheumatoid arthritis     101705558 (Cxcl1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101705558 (Cxcl1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101705558 (Cxcl1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101705558 (Cxcl1) Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Chemokines    101705558 (Cxcl1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  101705558 NCBI-ProteinID:  XP_004833975 LinkDB All DBs Position Un AA seq 134 aa AA seqDB search MAHTAPSALRPVPLLLLLLLLVTGAARRAAGAPVTTELRCRCLQPVRGLHPKSIQSVAVT APGPHCHQTEVVATLKDGRVACLDPEAPMVQRVLQRMLSKCVGLCVHGAGSDLRPEIIPG NRVQLRDKERGFHN NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atggcccacaccgcccccagtgccctgcgccccgtgccactgctgctgctgctgctgctg ctggtgacgggagccgcccggagagccgcaggagcgcctgtgaccaccgagctgcgctgc cgctgtctgcagcctgtgcgcgggctgcaccccaagagtatccagagcgtagccgtgacg gcgccgggaccccactgccaccaaaccgaagtcgtggccacgctcaaggatggacgtgta gcctgcctagacccggaggccccgatggtgcagagagtcctgcagagaatgctgagcaag tgcgtggggctgtgcgtgcacggggcggggtcagacctgcgccctgaaatcataccgggg aaccgggtgcagctgcgggacaaggagcggggtttccataactga

DBGET integrated database retrieval system