Heterocephalus glaber (naked mole-rat): 101706414 Help Entry 101706414         CDS       T02812                                  Symbol Il4 Name (RefSeq) interleukin 4   KO K05430   interleukin 4 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04060   Cytokine-cytokine receptor interaction hgl04151   PI3K-Akt signaling pathway hgl04630   JAK-STAT signaling pathway hgl04640   Hematopoietic cell lineage hgl04657   IL-17 signaling pathway hgl04658   Th1 and Th2 cell differentiation hgl04659   Th17 cell differentiation hgl04660   T cell receptor signaling pathway hgl04664   Fc epsilon RI signaling pathway hgl04672   Intestinal immune network for IgA production hgl05140   Leishmaniasis hgl05200   Pathways in cancer hgl05310   Asthma hgl05320   Autoimmune thyroid disease hgl05321   Inflammatory bowel disease hgl05330   Allograft rejection Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101706414 (Il4)    04151 PI3K-Akt signaling pathway     101706414 (Il4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101706414 (Il4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     101706414 (Il4)    04660 T cell receptor signaling pathway     101706414 (Il4)    04658 Th1 and Th2 cell differentiation     101706414 (Il4)    04659 Th17 cell differentiation     101706414 (Il4)    04657 IL-17 signaling pathway     101706414 (Il4)    04664 Fc epsilon RI signaling pathway     101706414 (Il4)    04672 Intestinal immune network for IgA production     101706414 (Il4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101706414 (Il4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     101706414 (Il4)   09163 Immune disease    05310 Asthma     101706414 (Il4)    05320 Autoimmune thyroid disease     101706414 (Il4)    05321 Inflammatory bowel disease     101706414 (Il4)    05330 Allograft rejection     101706414 (Il4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101706414 (Il4)    00536 Glycosaminoglycan binding proteins [BR:hgl00536]     101706414 (Il4) Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Interleukins    101706414 (Il4) Glycosaminoglycan binding proteins [BR:hgl00536]  Heparan sulfate / Heparin   Cytokines    101706414 (Il4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL4 Motif Other DBs NCBI-GeneID:  101706414 NCBI-ProteinID:  XP_012932792 UniProt:  G5ASQ0 LinkDB All DBs Position Un AA seq 140 aa AA seqDB search MGLVPQLTVTLFCLLACTGTFVRGCNDALQEIINDLNVLSSQKTPCAELAAADVFAAPKD TAEKLCQAVTVLHRTSYLGVGLSCLNRHRESVFLVLLKKVYRNLRSMVQPNCSVSELKQT TLKDFLENLKTILKKKYSEC NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atgggtcttgtcccccagctgacagtcaccctgttctgcctcctagcatgtaccggcacc ttcgtccgtggctgcaacgatgccttacaagaaatcatcaatgatctgaatgtgctctca agccaaaagactccatgtgctgagctggctgctgcagacgtcttcgctgcccccaaggac acagccgagaagctgtgccaggctgtgacagtgctgcatcgcacatcctacctcggggtg gggctttcgtgcctgaacagacacagagaatcagtctttctggttctcctgaagaaggtc tacaggaacctcaggagcatggttcagccgaactgttctgtgagtgaactcaagcagacg acgttgaaagacttcttggaaaacctaaaaacgatcctgaaaaagaaatactcagagtgt tga

DBGET integrated database retrieval system