Heterocephalus glaber (naked mole-rat): 101709972 Help Entry 101709972         CDS       T02812                                  Symbol Fadd Name (RefSeq) Fas associated via death domain   KO K02373   FAS-associated death domain protein Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl01524   Platinum drug resistance hgl04210   Apoptosis hgl04215   Apoptosis - multiple species hgl04217   Necroptosis hgl04620   Toll-like receptor signaling pathway hgl04621   NOD-like receptor signaling pathway hgl04622   RIG-I-like receptor signaling pathway hgl04623   Cytosolic DNA-sensing pathway hgl04657   IL-17 signaling pathway hgl04668   TNF signaling pathway hgl04936   Alcoholic liver disease hgl05010   Alzheimer disease hgl05022   Pathways of neurodegeneration - multiple diseases hgl05132   Salmonella infection hgl05142   Chagas disease hgl05152   Tuberculosis hgl05160   Hepatitis C hgl05161   Hepatitis B hgl05162   Measles hgl05163   Human cytomegalovirus infection hgl05164   Influenza A hgl05165   Human papillomavirus infection hgl05167   Kaposi sarcoma-associated herpesvirus infection hgl05168   Herpes simplex virus 1 infection hgl05169   Epstein-Barr virus infection hgl05170   Human immunodeficiency virus 1 infection hgl05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     101709972 (Fadd)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     101709972 (Fadd)    04215 Apoptosis - multiple species     101709972 (Fadd)    04217 Necroptosis     101709972 (Fadd)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101709972 (Fadd)    04621 NOD-like receptor signaling pathway     101709972 (Fadd)    04622 RIG-I-like receptor signaling pathway     101709972 (Fadd)    04623 Cytosolic DNA-sensing pathway     101709972 (Fadd)    04657 IL-17 signaling pathway     101709972 (Fadd)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101709972 (Fadd)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101709972 (Fadd)    05161 Hepatitis B     101709972 (Fadd)    05160 Hepatitis C     101709972 (Fadd)    05164 Influenza A     101709972 (Fadd)    05162 Measles     101709972 (Fadd)    05168 Herpes simplex virus 1 infection     101709972 (Fadd)    05163 Human cytomegalovirus infection     101709972 (Fadd)    05167 Kaposi sarcoma-associated herpesvirus infection     101709972 (Fadd)    05169 Epstein-Barr virus infection     101709972 (Fadd)    05165 Human papillomavirus infection     101709972 (Fadd)   09171 Infectious disease: bacterial    05132 Salmonella infection     101709972 (Fadd)    05152 Tuberculosis     101709972 (Fadd)   09174 Infectious disease: parasitic    05142 Chagas disease     101709972 (Fadd)   09164 Neurodegenerative disease    05010 Alzheimer disease     101709972 (Fadd)    05022 Pathways of neurodegeneration - multiple diseases     101709972 (Fadd)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101709972 (Fadd)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     101709972 (Fadd) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DED Death tRNA_NucTran2_2 EAL Motif Other DBs NCBI-GeneID:  101709972 NCBI-ProteinID:  XP_004852218 UniProt:  G5BSS5 LinkDB All DBs Position Un AA seq 197 aa AA seqDB search MDPFLVLLHSLSASLSSSEVTELKFLCHGRVGKRKLERVQCGLDLFSVLLEQNDLDPENT GLLRELLASLRRHDLLQRLDNFEAGATSRASPGEADLRAAFDVICDNVGRDWRRLARQLN VSDTKIDGIEERYPRNLSERVRESLRIWKNSEKENATVAHLVQVLRSCKMNLVADLVEEE QRARTSQNESGSMSPLT NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atggacccattcctggtgctgctgcactctttgtcagccagcctgtctagcagcgaggtg actgaactcaagttcttatgccacgggcgcgtgggcaagaggaagctggagcgcgtgcag tgcggcctcgacctcttctcggtgctgctagagcagaacgatctggaccccgagaacacc gggctgctgcgggagctgctggcctccctgcggcgtcacgacctgctacagcgcctagac aacttcgaggcgggggctacctccagggcatcgccgggggaggcagacctgcgcgcagca tttgacgtcatctgtgataatgtgggaagagactggagaagactggctcgtcagcttaat gtttctgacactaagattgatggaatcgaggagcgatacccccgcaacctgtcagagcgg gtgagagagtcgctgaggatctggaagaactcagagaaggagaacgcgactgtggcccac ctggtgcaagtcctcaggagctgcaaaatgaacctggtggctgaccttgtggaagaggaa cagcgggcccggacgtcccaaaatgagagcggaagcatgtccccattgacatga

DBGET integrated database retrieval system