Heterocephalus glaber (naked mole-rat): 101712534 Help Entry 101712534         CDS       T02812                                  Symbol Cd3d Name (RefSeq) CD3d molecule   KO K06450   T-cell surface glycoprotein CD3 delta chain Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04640   Hematopoietic cell lineage hgl04658   Th1 and Th2 cell differentiation hgl04659   Th17 cell differentiation hgl04660   T cell receptor signaling pathway hgl05142   Chagas disease hgl05162   Measles hgl05166   Human T-cell leukemia virus 1 infection hgl05169   Epstein-Barr virus infection hgl05170   Human immunodeficiency virus 1 infection hgl05235   PD-L1 expression and PD-1 checkpoint pathway in cancer hgl05340   Primary immunodeficiency Brite KEGG Orthology (KO) [BR:hgl00001]  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     101712534 (Cd3d)    04660 T cell receptor signaling pathway     101712534 (Cd3d)    04658 Th1 and Th2 cell differentiation     101712534 (Cd3d)    04659 Th17 cell differentiation     101712534 (Cd3d)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101712534 (Cd3d)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101712534 (Cd3d)    05170 Human immunodeficiency virus 1 infection     101712534 (Cd3d)    05162 Measles     101712534 (Cd3d)    05169 Epstein-Barr virus infection     101712534 (Cd3d)   09174 Infectious disease: parasitic    05142 Chagas disease     101712534 (Cd3d)   09163 Immune disease    05340 Primary immunodeficiency     101712534 (Cd3d)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04090 CD molecules [BR:hgl04090]     101712534 (Cd3d) CD molecules [BR:hgl04090]  Proteins   101712534 (Cd3d) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ig_4 ITAM Ig_5 Motif Other DBs NCBI-GeneID:  101712534 NCBI-ProteinID:  XP_004856756 UniProt:  A0AAX6PQD8 LinkDB All DBs Position Un AA seq 171 aa AA seqDB search MKHSRFLTGLVLAALLPQVNPFQIPVEEFEDKVFVDCNTSVTWLDGTVGTKRANGVRLDL GKRLLDPRGVYKCLGTDIYDKKESTVQVYYRMCQSCVEMDSATLAGIIVTDIIATLLLAL GVYCFAGHETGRLSGGADTQALLKNDQLYQPLRDREDAQYSRLGENWHRSK NT seq 516 nt NT seq  +upstreamnt  +downstreamnt atgaaacatagcaggtttctgactggtctggtcctggctgcccttctccctcaagtgaac cccttccagatacctgtggaggaatttgaggacaaagtatttgtggattgcaataccagc gtcacatggctagatggaacagtagggacaaagagagcaaatggtgtccgtctggacttg ggaaaacgtctcctggatccacgaggagtgtataagtgtttggggaccgatatatatgac aagaaagaatctactgtgcaagtatattatcgaatgtgccagagctgtgtggagatggac tccgccacccttgctggcatcattgtcactgacatcattgccactctgctccttgctttg ggagtctactgctttgcaggacatgagactggaaggctctctggaggggctgacactcaa gctctgttgaagaatgaccagctttatcagcctctgcgagatcgtgaggatgctcagtac agccgtcttggagaaaactggcaccggagcaaatga

DBGET integrated database retrieval system