Heterocephalus glaber (naked mole-rat): 101714409 Help Entry 101714409         CDS       T02812                                  Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04010   MAPK signaling pathway hgl04014   Ras signaling pathway hgl04015   Rap1 signaling pathway hgl04024   cAMP signaling pathway hgl04062   Chemokine signaling pathway hgl04510   Focal adhesion hgl04520   Adherens junction hgl04611   Platelet activation hgl04670   Leukocyte transendothelial migration hgl04720   Long-term potentiation hgl04722   Neurotrophin signaling pathway hgl04934   Cushing syndrome hgl04972   Pancreatic secretion hgl05211   Renal cell carcinoma hgl05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101714409    04014 Ras signaling pathway     101714409    04015 Rap1 signaling pathway     101714409    04024 cAMP signaling pathway     101714409  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     101714409    04520 Adherens junction     101714409  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     101714409    04670 Leukocyte transendothelial migration     101714409    04062 Chemokine signaling pathway     101714409   09154 Digestive system    04972 Pancreatic secretion     101714409   09156 Nervous system    04720 Long-term potentiation     101714409    04722 Neurotrophin signaling pathway     101714409  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     101714409   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101714409   09167 Endocrine and metabolic disease    04934 Cushing syndrome     101714409  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hgl04147]     101714409    04031 GTP-binding proteins [BR:hgl04031]     101714409 Exosome [BR:hgl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101714409   Exosomal proteins of other body fluids (saliva and urine)    101714409   Exosomal proteins of colorectal cancer cells    101714409 GTP-binding proteins [BR:hgl04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     101714409 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU G-alpha MMR_HSR1 FNG PglD_N RsgA_GTPase Motif Other DBs NCBI-GeneID:  101714409 NCBI-ProteinID:  XP_004854521 UniProt:  A0AAX6PLC0 LinkDB All DBs Position Un AA seq 186 aa AA seqDB search MRQYKLVILGSGGFGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAHQCMLETLDTAG TEQFTAVRDLYMKNGQVYLFALVYSITAQSTFNDLQDLREQILQVKDTDDVPMILVGNKC DLEDERVIGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVQQINRKTSVPGKALKK LSCQLL NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgcgtcagtataagctagtcattcttggctcaggaggctttggaaagtctgctctgact gtacagtttgttcaaggaatttttgttgaaaagtatgatcctacaatagaagattcttat agaaagcaagttgaagtagatgcacaccagtgtatgcttgaaactttggatactgcagga acggaacaatttacagcagtgagagatttgtacatgaaaaatggacaagtttatttattt gctttagtttattccatcacagcacagtccacatttaatgatttacaagatctgagagaa cagattcttcaagttaaagacactgatgatgttccaatgattctggttggtaataaatgt gacttggaagatgaaagagtcataggaaaggaacaaggtcaaaatctagcaagacagtgg aacaactgtgcattcttagaatcttctgcaaaatcaaaaataaatgttaatgagatcttt tatgacctagtgcagcaaattaacagaaaaacttcagtgcctgggaaggccctcaaaaag ttatcatgtcagctgctttaa

DBGET integrated database retrieval system