Heterocephalus glaber (naked mole-rat): 101718432 Help Entry 101718432         CDS       T02812                                  Symbol Tnf Name (RefSeq) tumor necrosis factor   KO K03156   tumor necrosis factor superfamily, member 2 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl01523   Antifolate resistance hgl04010   MAPK signaling pathway hgl04060   Cytokine-cytokine receptor interaction hgl04061   Viral protein interaction with cytokine and cytokine receptor hgl04064   NF-kappa B signaling pathway hgl04071   Sphingolipid signaling pathway hgl04150   mTOR signaling pathway hgl04210   Apoptosis hgl04217   Necroptosis hgl04350   TGF-beta signaling pathway hgl04380   Osteoclast differentiation hgl04612   Antigen processing and presentation hgl04620   Toll-like receptor signaling pathway hgl04621   NOD-like receptor signaling pathway hgl04622   RIG-I-like receptor signaling pathway hgl04625   C-type lectin receptor signaling pathway hgl04640   Hematopoietic cell lineage hgl04650   Natural killer cell mediated cytotoxicity hgl04657   IL-17 signaling pathway hgl04660   T cell receptor signaling pathway hgl04664   Fc epsilon RI signaling pathway hgl04668   TNF signaling pathway hgl04920   Adipocytokine signaling pathway hgl04930   Type II diabetes mellitus hgl04931   Insulin resistance hgl04932   Non-alcoholic fatty liver disease hgl04933   AGE-RAGE signaling pathway in diabetic complications hgl04936   Alcoholic liver disease hgl04940   Type I diabetes mellitus hgl05010   Alzheimer disease hgl05014   Amyotrophic lateral sclerosis hgl05020   Prion disease hgl05022   Pathways of neurodegeneration - multiple diseases hgl05132   Salmonella infection hgl05133   Pertussis hgl05134   Legionellosis hgl05135   Yersinia infection hgl05140   Leishmaniasis hgl05142   Chagas disease hgl05143   African trypanosomiasis hgl05144   Malaria hgl05145   Toxoplasmosis hgl05146   Amoebiasis hgl05152   Tuberculosis hgl05160   Hepatitis C hgl05161   Hepatitis B hgl05163   Human cytomegalovirus infection hgl05164   Influenza A hgl05165   Human papillomavirus infection hgl05166   Human T-cell leukemia virus 1 infection hgl05168   Herpes simplex virus 1 infection hgl05169   Epstein-Barr virus infection hgl05170   Human immunodeficiency virus 1 infection hgl05171   Coronavirus disease - COVID-19 hgl05205   Proteoglycans in cancer hgl05310   Asthma hgl05321   Inflammatory bowel disease hgl05322   Systemic lupus erythematosus hgl05323   Rheumatoid arthritis hgl05330   Allograft rejection hgl05332   Graft-versus-host disease hgl05410   Hypertrophic cardiomyopathy hgl05414   Dilated cardiomyopathy hgl05417   Lipid and atherosclerosis hgl05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101718432 (Tnf)    04350 TGF-beta signaling pathway     101718432 (Tnf)    04064 NF-kappa B signaling pathway     101718432 (Tnf)    04668 TNF signaling pathway     101718432 (Tnf)    04071 Sphingolipid signaling pathway     101718432 (Tnf)    04150 mTOR signaling pathway     101718432 (Tnf)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101718432 (Tnf)    04061 Viral protein interaction with cytokine and cytokine receptor     101718432 (Tnf)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     101718432 (Tnf)    04217 Necroptosis     101718432 (Tnf)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     101718432 (Tnf)    04620 Toll-like receptor signaling pathway     101718432 (Tnf)    04621 NOD-like receptor signaling pathway     101718432 (Tnf)    04622 RIG-I-like receptor signaling pathway     101718432 (Tnf)    04625 C-type lectin receptor signaling pathway     101718432 (Tnf)    04650 Natural killer cell mediated cytotoxicity     101718432 (Tnf)    04612 Antigen processing and presentation     101718432 (Tnf)    04660 T cell receptor signaling pathway     101718432 (Tnf)    04657 IL-17 signaling pathway     101718432 (Tnf)    04664 Fc epsilon RI signaling pathway     101718432 (Tnf)   09152 Endocrine system    04920 Adipocytokine signaling pathway     101718432 (Tnf)   09158 Development and regeneration    04380 Osteoclast differentiation     101718432 (Tnf)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     101718432 (Tnf)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101718432 (Tnf)    05170 Human immunodeficiency virus 1 infection     101718432 (Tnf)    05161 Hepatitis B     101718432 (Tnf)    05160 Hepatitis C     101718432 (Tnf)    05171 Coronavirus disease - COVID-19     101718432 (Tnf)    05164 Influenza A     101718432 (Tnf)    05168 Herpes simplex virus 1 infection     101718432 (Tnf)    05163 Human cytomegalovirus infection     101718432 (Tnf)    05169 Epstein-Barr virus infection     101718432 (Tnf)    05165 Human papillomavirus infection     101718432 (Tnf)   09171 Infectious disease: bacterial    05132 Salmonella infection     101718432 (Tnf)    05135 Yersinia infection     101718432 (Tnf)    05133 Pertussis     101718432 (Tnf)    05134 Legionellosis     101718432 (Tnf)    05152 Tuberculosis     101718432 (Tnf)   09174 Infectious disease: parasitic    05146 Amoebiasis     101718432 (Tnf)    05144 Malaria     101718432 (Tnf)    05145 Toxoplasmosis     101718432 (Tnf)    05140 Leishmaniasis     101718432 (Tnf)    05142 Chagas disease     101718432 (Tnf)    05143 African trypanosomiasis     101718432 (Tnf)   09163 Immune disease    05310 Asthma     101718432 (Tnf)    05322 Systemic lupus erythematosus     101718432 (Tnf)    05323 Rheumatoid arthritis     101718432 (Tnf)    05321 Inflammatory bowel disease     101718432 (Tnf)    05330 Allograft rejection     101718432 (Tnf)    05332 Graft-versus-host disease     101718432 (Tnf)   09164 Neurodegenerative disease    05010 Alzheimer disease     101718432 (Tnf)    05014 Amyotrophic lateral sclerosis     101718432 (Tnf)    05020 Prion disease     101718432 (Tnf)    05022 Pathways of neurodegeneration - multiple diseases     101718432 (Tnf)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101718432 (Tnf)    05418 Fluid shear stress and atherosclerosis     101718432 (Tnf)    05410 Hypertrophic cardiomyopathy     101718432 (Tnf)    05414 Dilated cardiomyopathy     101718432 (Tnf)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     101718432 (Tnf)    04940 Type I diabetes mellitus     101718432 (Tnf)    04936 Alcoholic liver disease     101718432 (Tnf)    04932 Non-alcoholic fatty liver disease     101718432 (Tnf)    04931 Insulin resistance     101718432 (Tnf)    04933 AGE-RAGE signaling pathway in diabetic complications     101718432 (Tnf)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     101718432 (Tnf)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101718432 (Tnf)    00536 Glycosaminoglycan binding proteins [BR:hgl00536]     101718432 (Tnf) Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Tumor necrosis fators    101718432 (Tnf) Glycosaminoglycan binding proteins [BR:hgl00536]  Heparan sulfate / Heparin   Cytokines    101718432 (Tnf) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TNF PD-C2-AF1 Motif Other DBs NCBI-GeneID:  101718432 NCBI-ProteinID:  XP_004847074 UniProt:  G5C3E2 LinkDB All DBs Position Un AA seq 230 aa AA seqDB search MSTESMIRDVELAGEEPLQKAGGPQGSGRCWCLSFFSFLLVAGATTLFCLLHFGVIGPQR GEFKDLNFFSPLFSTGSASQSGNDKPVAHVVANQQGQEKLEWLSKRANALLANGMDLTDN QLVVPSDGLYLVYSQVLFKGQGCPSYVLLTHTVSRLAISYQDKVNLLSAIKSPCQKETPE GAELKPWYEPVYLGGVFQLQKGDRLSAEVNLPDYLDFAESGQIYFGAIAL NT seq 693 nt NT seq  +upstreamnt  +downstreamnt atgagcacagaaagcatgatccgggacgtggagctcgctggggaggagcccctccagaag gcagggggcccccagggctccgggcggtgctggtgcctcagcttcttctccttcctgctc gtggcaggagccaccacgctcttctgcctgctgcacttcggggtgatcggcccccagcgg ggagagtttaaggatctcaactttttctctcctctgttctccacaggatcagcttctcaa agcgggaatgacaagcctgttgctcatgttgtagcaaaccaacaaggacaggagaagctg gagtggctgagcaagcgtgccaatgccctcttggccaatggcatggatctaacggacaac cagctggtggtgccttcggacgggctgtacctcgtctactcccaggtcctcttcaagggc caaggctgcccctcctacgtcctcctcacccatactgtcagccgcctagccatctcctac caggacaaggtcaacctcctgtctgccatcaagagtccctgccagaaggagaccccagag ggggctgagctcaagccctggtatgagcccgtctacctgggaggggtcttccagctgcag aagggagaccgcctcagtgccgaggtcaatctgcccgactatcttgacttcgcggagtcc gggcagatctacttcggggccattgccctgtga

DBGET integrated database retrieval system