Heterocephalus glaber (naked mole-rat): 101722912 Help Entry 101722912         CDS       T02812                                  Symbol Cxcl12 Name (RefSeq) C-X-C motif chemokine ligand 12   KO K10031   C-X-C motif chemokine 12 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04060   Cytokine-cytokine receptor interaction hgl04061   Viral protein interaction with cytokine and cytokine receptor hgl04062   Chemokine signaling pathway hgl04064   NF-kappa B signaling pathway hgl04360   Axon guidance hgl04670   Leukocyte transendothelial migration hgl04672   Intestinal immune network for IgA production hgl04810   Regulation of actin cytoskeleton hgl05163   Human cytomegalovirus infection hgl05200   Pathways in cancer hgl05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     101722912 (Cxcl12)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101722912 (Cxcl12)    04061 Viral protein interaction with cytokine and cytokine receptor     101722912 (Cxcl12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101722912 (Cxcl12)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     101722912 (Cxcl12)    04672 Intestinal immune network for IgA production     101722912 (Cxcl12)    04062 Chemokine signaling pathway     101722912 (Cxcl12)   09158 Development and regeneration    04360 Axon guidance     101722912 (Cxcl12)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101722912 (Cxcl12)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     101722912 (Cxcl12)   09163 Immune disease    05323 Rheumatoid arthritis     101722912 (Cxcl12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101722912 (Cxcl12)    00536 Glycosaminoglycan binding proteins [BR:hgl00536]     101722912 (Cxcl12) Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Chemokines    101722912 (Cxcl12) Glycosaminoglycan binding proteins [BR:hgl00536]  Heparan sulfate / Heparin   Chemokines    101722912 (Cxcl12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  101722912 NCBI-ProteinID:  XP_004874164 UniProt:  A0A0P6JB39 LinkDB All DBs Position Un AA seq 119 aa AA seqDB search MDAKVVAVLALVLAALCLGDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV ARLKSNNRQVCIDPKLKWIQEYLEKALNKGRREEKVGKKEKIGKKKRQKKRKAAQKRKN NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgccaaggtcgtcgccgtgctggccctcgtgctggccgctctctgcctcggagac gggaaacctgtcagcctgagctacagatgtccctgccgcttctttgagagccacgtggcc agagccaatgtcaagcacctcaaaatcctcaacactccgaactgcgcccttcagattgtc gccaggctgaagagcaacaacaggcaggtgtgcatcgacccgaagctgaagtggatccag gagtacctggagaaggctttaaacaaggggcgcagagaagaaaaagtggggaaaaaagaa aagataggaaaaaagaagcgacagaagaagagaaaggctgcccagaaaagaaaaaactag

DBGET integrated database retrieval system