Harpia harpyja (harpy eagle): 128135561 Help Entry 128135561         CDS       T10541                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism hhar  Harpia harpyja (harpy eagle) Pathway hhar03050   Proteasome hhar04060   Cytokine-cytokine receptor interaction hhar04217   Necroptosis hhar04350   TGF-beta signaling pathway hhar05164   Influenza A hhar05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:hhar00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     128135561 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     128135561 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     128135561 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     128135561 (IFNG)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     128135561 (IFNG)    05168 Herpes simplex virus 1 infection     128135561 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:hhar03051]     128135561 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hhar04052]     128135561 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:hhar00536]     128135561 (IFNG) Proteasome [BR:hhar03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     128135561 (IFNG) Cytokines and neuropeptides [BR:hhar04052]  Cytokines   Interferons    128135561 (IFNG) Glycosaminoglycan binding proteins [BR:hhar00536]  Heparan sulfate / Heparin   Cytokines    128135561 (IFNG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma ATG17_like DUF4422 Motif Other DBs NCBI-GeneID:  128135561 NCBI-ProteinID:  XP_052630541 LinkDB All DBs Position 23:16323187..16326738 Genome browser AA seq 165 aa AA seqDB search MTCQTYSFLVLSVIMIYFGRFGNSLILAQLQDDIDQLKADFNSSHSDVADGGPIFTDKLI NWTERNEKRIILSQIVSMYLEMLEKTAEKKAHARHIVEELYTLKASLPDGLQKVKDLMDL SKIQMSDLRIQRKAANELFSVLQKLVETSTSLKRKRSQSQRRCKC NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atgacttgtcagacctacagctttcttgttctgtctgtcatcatgatttattttggacgt tttggaaatagcttaatccttgctcaacttcaagatgatatagaccaactgaaagctgac tttaactcaagtcattcagacgtagctgacggtggacctatttttacagataaactgata aactggacagagagaaatgaaaaaaggatcatcctgagccagattgtttccatgtacttg gaaatgcttgaaaaaactgccgagaaaaaggcgcacgccaggcatatagtcgaggagctc tatactctgaaagcaagccttcctgatggcttacagaaggtgaaagacctcatggacctc tcaaagattcagatgagcgacctgagaattcaacgcaaagctgcgaacgagctgttcagc gtcttacaaaaactggtggagacttcaacttctctcaaaaggaaaaggagccagtctcag aggaggtgcaaatgctaa

DBGET integrated database retrieval system