Hyaena hyaena (striped hyena): 120223325 Help Entry 120223325         CDS       T07257                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04060   Cytokine-cytokine receptor interaction hhv04151   PI3K-Akt signaling pathway hhv04630   JAK-STAT signaling pathway hhv04640   Hematopoietic cell lineage hhv04657   IL-17 signaling pathway hhv04658   Th1 and Th2 cell differentiation hhv04659   Th17 cell differentiation hhv04660   T cell receptor signaling pathway hhv04664   Fc epsilon RI signaling pathway hhv04672   Intestinal immune network for IgA production hhv05140   Leishmaniasis hhv05200   Pathways in cancer hhv05310   Asthma hhv05320   Autoimmune thyroid disease hhv05321   Inflammatory bowel disease hhv05330   Allograft rejection Brite KEGG Orthology (KO) [BR:hhv00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     120223325 (IL4)    04151 PI3K-Akt signaling pathway     120223325 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120223325 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     120223325 (IL4)    04660 T cell receptor signaling pathway     120223325 (IL4)    04658 Th1 and Th2 cell differentiation     120223325 (IL4)    04659 Th17 cell differentiation     120223325 (IL4)    04657 IL-17 signaling pathway     120223325 (IL4)    04664 Fc epsilon RI signaling pathway     120223325 (IL4)    04672 Intestinal immune network for IgA production     120223325 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120223325 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     120223325 (IL4)   09163 Immune disease    05310 Asthma     120223325 (IL4)    05320 Autoimmune thyroid disease     120223325 (IL4)    05321 Inflammatory bowel disease     120223325 (IL4)    05330 Allograft rejection     120223325 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hhv04052]     120223325 (IL4)    00536 Glycosaminoglycan binding proteins [BR:hhv00536]     120223325 (IL4) Cytokines and neuropeptides [BR:hhv04052]  Cytokines   Interleukins    120223325 (IL4) Glycosaminoglycan binding proteins [BR:hhv00536]  Heparan sulfate / Heparin   Cytokines    120223325 (IL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL4 LysM14_C Motif Other DBs NCBI-GeneID:  120223325 NCBI-ProteinID:  XP_039077316 LinkDB All DBs Position Unknown AA seq 133 aa AA seqDB search MDLTSQLIPTLVCLLAFTSTFVHGQNFNIRLREIIKTLNILTARNDSCMELTVMDVLAAP KNTSDQEIFCRATTVLRQTYTHPNCSTRFLRGLDKNLWSMANRTCAVNEVKKCTLKDLLE RLKAIVQKIYSKH NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atggatctcacctcccaactgattccaactctggtctgcttactagcatttaccagcacc ttcgtccacggccagaacttcaatatcaggttgagagagatcatcaaaacgttgaacatc ctcacagcaagaaacgactcgtgtatggagctgaccgtcatggacgtcttggctgcccca aagaacacaagtgatcaggaaatcttctgcagagccacaactgtgctccggcagacctat acacaccccaactgctcgaccagattcctcagaggactcgacaagaacctctggagcatg gcaaacaggacctgtgctgtgaatgaagtcaagaagtgtacactgaaagacctgttggaa aggctaaaagcgatcgtgcaaaagatatactcaaagcactga

DBGET integrated database retrieval system