Hyaena hyaena (striped hyena): 120237005 Help Entry 120237005         CDS       T07257                                  Symbol POLE4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv03030   DNA replication hhv03410   Base excision repair hhv03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:hhv00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     120237005 (POLE4)    03410 Base excision repair     120237005 (POLE4)    03420 Nucleotide excision repair     120237005 (POLE4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:hhv03032]     120237005 (POLE4)    03400 DNA repair and recombination proteins [BR:hhv03400]     120237005 (POLE4) Enzymes [BR:hhv01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      120237005 (POLE4) DNA replication proteins [BR:hhv03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     120237005 (POLE4) DNA repair and recombination proteins [BR:hhv03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       120237005 (POLE4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone TAF CENP-T_C Motif Other DBs NCBI-GeneID:  120237005 NCBI-ProteinID:  XP_039096062 LinkDB All DBs Position Unknown AA seq 115 aa AA seqDB search MAAAAGNGTPREEEGPSGEAAAPPPQAPTIAPGARLSRLPLARVKALVKADPDVTLAGQE AIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcggctggaaatgggacaccccgggaggaggaggggcccagtggggaggca gcggccccgccgccgcaagccccgacaattgcgcccggagctcgtctctcgaggttgccg ttagcgagagtgaaggccttggtgaaggcggaccccgacgtgaccctcgcgggacaggaa gccatcttcattctggcacgagcagcggaactatttgtggagaccattgcaaaagatgcc tactgctgtgctcaacaaggaaagaggaaaaccctgcagaggagagatttggataatgca atagaagccgtggatgaatttgcttttctggaaggaactttggattga

DBGET integrated database retrieval system