Hyaena hyaena (striped hyena): 120245581 Help Entry 120245581         CDS       T07257                                  Symbol IL10 Name (RefSeq) interleukin-10   KO K05443   interleukin 10 Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04060   Cytokine-cytokine receptor interaction hhv04061   Viral protein interaction with cytokine and cytokine receptor hhv04068   FoxO signaling pathway hhv04148   Efferocytosis hhv04625   C-type lectin receptor signaling pathway hhv04630   JAK-STAT signaling pathway hhv04660   T cell receptor signaling pathway hhv04672   Intestinal immune network for IgA production hhv05133   Pertussis hhv05135   Yersinia infection hhv05140   Leishmaniasis hhv05142   Chagas disease hhv05143   African trypanosomiasis hhv05144   Malaria hhv05145   Toxoplasmosis hhv05146   Amoebiasis hhv05150   Staphylococcus aureus infection hhv05152   Tuberculosis hhv05310   Asthma hhv05320   Autoimmune thyroid disease hhv05321   Inflammatory bowel disease hhv05322   Systemic lupus erythematosus hhv05330   Allograft rejection Brite KEGG Orthology (KO) [BR:hhv00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     120245581 (IL10)    04068 FoxO signaling pathway     120245581 (IL10)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120245581 (IL10)    04061 Viral protein interaction with cytokine and cytokine receptor     120245581 (IL10)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     120245581 (IL10)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120245581 (IL10)    04660 T cell receptor signaling pathway     120245581 (IL10)    04672 Intestinal immune network for IgA production     120245581 (IL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     120245581 (IL10)    05133 Pertussis     120245581 (IL10)    05150 Staphylococcus aureus infection     120245581 (IL10)    05152 Tuberculosis     120245581 (IL10)   09174 Infectious disease: parasitic    05146 Amoebiasis     120245581 (IL10)    05144 Malaria     120245581 (IL10)    05145 Toxoplasmosis     120245581 (IL10)    05140 Leishmaniasis     120245581 (IL10)    05142 Chagas disease     120245581 (IL10)    05143 African trypanosomiasis     120245581 (IL10)   09163 Immune disease    05310 Asthma     120245581 (IL10)    05322 Systemic lupus erythematosus     120245581 (IL10)    05320 Autoimmune thyroid disease     120245581 (IL10)    05321 Inflammatory bowel disease     120245581 (IL10)    05330 Allograft rejection     120245581 (IL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hhv04052]     120245581 (IL10)    00536 Glycosaminoglycan binding proteins [BR:hhv00536]     120245581 (IL10) Cytokines and neuropeptides [BR:hhv04052]  Cytokines   Interleukins    120245581 (IL10) Glycosaminoglycan binding proteins [BR:hhv00536]  Heparan sulfate / Heparin   Cytokines    120245581 (IL10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL10 IL22 Guanylate_kin ALIX_LYPXL_bnd CLZ RH_dom Phage_int_SAM_5 Motif Other DBs NCBI-GeneID:  120245581 NCBI-ProteinID:  XP_039108591 LinkDB All DBs Position Unknown AA seq 178 aa AA seqDB search MPSPALLCFLVFLAGVGASRHQSTLFEDNCTHFSTSLPHMLRELRAAFGKVKTFFQTKDQ LNSMLLTRSLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKQHVNSLGEKLKTLR LRLRRCHRFLPCENKSKVVEQVKSTFNKLQEKGVYKAMGEFDIFINYIEAYMTLKMKI NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgcccagcccagcacttctgtgtttcctggtcttcctcgccggcgtgggagccagccga caccagagcaccctatttgaggacaactgcacccacttctcgaccagcctgccccacatg ctccgagagctccgagctgccttcggcaaggtgaagactttctttcaaacgaaggaccag ctgaacagcatgttgctgactagatccttgctggaggactttaagggttacctgggttgc caagccttgtcggagatgatccagttttacttggaggaggtgatgccccaggctgagaac cacgacccagacatcaaacagcacgtgaattccctgggagaaaagctgaagaccctgagg ctgaggctgcggcgctgtcatcgatttctgccctgtgaaaacaagagcaaggtggtggag caggtgaagagtacctttaataagctccaagagaaaggtgtctacaaagccatgggtgag tttgacatcttcatcaactacatagaagcttacatgacattgaagatgaaaatctga

DBGET integrated database retrieval system