KEGG   Hyaena hyaena (striped hyena): 120247089
Entry
120247089         CDS       T07257                                 
Name
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
hhv  Hyaena hyaena (striped hyena)
Pathway
hhv01521  EGFR tyrosine kinase inhibitor resistance
hhv01522  Endocrine resistance
hhv01524  Platinum drug resistance
hhv04012  ErbB signaling pathway
hhv04014  Ras signaling pathway
hhv04015  Rap1 signaling pathway
hhv04024  cAMP signaling pathway
hhv04062  Chemokine signaling pathway
hhv04066  HIF-1 signaling pathway
hhv04068  FoxO signaling pathway
hhv04070  Phosphatidylinositol signaling system
hhv04071  Sphingolipid signaling pathway
hhv04072  Phospholipase D signaling pathway
hhv04081  Hormone signaling
hhv04140  Autophagy - animal
hhv04150  mTOR signaling pathway
hhv04151  PI3K-Akt signaling pathway
hhv04152  AMPK signaling pathway
hhv04210  Apoptosis
hhv04211  Longevity regulating pathway
hhv04213  Longevity regulating pathway - multiple species
hhv04218  Cellular senescence
hhv04360  Axon guidance
hhv04370  VEGF signaling pathway
hhv04380  Osteoclast differentiation
hhv04510  Focal adhesion
hhv04550  Signaling pathways regulating pluripotency of stem cells
hhv04611  Platelet activation
hhv04613  Neutrophil extracellular trap formation
hhv04620  Toll-like receptor signaling pathway
hhv04625  C-type lectin receptor signaling pathway
hhv04630  JAK-STAT signaling pathway
hhv04650  Natural killer cell mediated cytotoxicity
hhv04660  T cell receptor signaling pathway
hhv04662  B cell receptor signaling pathway
hhv04664  Fc epsilon RI signaling pathway
hhv04666  Fc gamma R-mediated phagocytosis
hhv04668  TNF signaling pathway
hhv04670  Leukocyte transendothelial migration
hhv04722  Neurotrophin signaling pathway
hhv04725  Cholinergic synapse
hhv04750  Inflammatory mediator regulation of TRP channels
hhv04810  Regulation of actin cytoskeleton
hhv04910  Insulin signaling pathway
hhv04914  Progesterone-mediated oocyte maturation
hhv04915  Estrogen signaling pathway
hhv04917  Prolactin signaling pathway
hhv04919  Thyroid hormone signaling pathway
hhv04923  Regulation of lipolysis in adipocytes
hhv04926  Relaxin signaling pathway
hhv04929  GnRH secretion
hhv04930  Type II diabetes mellitus
hhv04931  Insulin resistance
hhv04932  Non-alcoholic fatty liver disease
hhv04933  AGE-RAGE signaling pathway in diabetic complications
hhv04935  Growth hormone synthesis, secretion and action
hhv04960  Aldosterone-regulated sodium reabsorption
hhv04973  Carbohydrate digestion and absorption
hhv05010  Alzheimer disease
hhv05017  Spinocerebellar ataxia
hhv05020  Prion disease
hhv05100  Bacterial invasion of epithelial cells
hhv05135  Yersinia infection
hhv05142  Chagas disease
hhv05146  Amoebiasis
hhv05160  Hepatitis C
hhv05161  Hepatitis B
hhv05162  Measles
hhv05163  Human cytomegalovirus infection
hhv05164  Influenza A
hhv05165  Human papillomavirus infection
hhv05166  Human T-cell leukemia virus 1 infection
hhv05167  Kaposi sarcoma-associated herpesvirus infection
hhv05168  Herpes simplex virus 1 infection
hhv05169  Epstein-Barr virus infection
hhv05170  Human immunodeficiency virus 1 infection
hhv05171  Coronavirus disease - COVID-19
hhv05200  Pathways in cancer
hhv05203  Viral carcinogenesis
hhv05205  Proteoglycans in cancer
hhv05206  MicroRNAs in cancer
hhv05207  Chemical carcinogenesis - receptor activation
hhv05208  Chemical carcinogenesis - reactive oxygen species
hhv05210  Colorectal cancer
hhv05211  Renal cell carcinoma
hhv05212  Pancreatic cancer
hhv05213  Endometrial cancer
hhv05214  Glioma
hhv05215  Prostate cancer
hhv05218  Melanoma
hhv05220  Chronic myeloid leukemia
hhv05221  Acute myeloid leukemia
hhv05222  Small cell lung cancer
hhv05223  Non-small cell lung cancer
hhv05224  Breast cancer
hhv05225  Hepatocellular carcinoma
hhv05226  Gastric cancer
hhv05230  Central carbon metabolism in cancer
hhv05231  Choline metabolism in cancer
hhv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hhv05415  Diabetic cardiomyopathy
hhv05417  Lipid and atherosclerosis
hhv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hhv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    120247089
   04014 Ras signaling pathway
    120247089
   04015 Rap1 signaling pathway
    120247089
   04370 VEGF signaling pathway
    120247089
   04630 JAK-STAT signaling pathway
    120247089
   04668 TNF signaling pathway
    120247089
   04066 HIF-1 signaling pathway
    120247089
   04068 FoxO signaling pathway
    120247089
   04070 Phosphatidylinositol signaling system
    120247089
   04072 Phospholipase D signaling pathway
    120247089
   04071 Sphingolipid signaling pathway
    120247089
   04024 cAMP signaling pathway
    120247089
   04151 PI3K-Akt signaling pathway
    120247089
   04152 AMPK signaling pathway
    120247089
   04150 mTOR signaling pathway
    120247089
  09133 Signaling molecules and interaction
   04081 Hormone signaling
    120247089
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    120247089
  09143 Cell growth and death
   04210 Apoptosis
    120247089
   04218 Cellular senescence
    120247089
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    120247089
   04550 Signaling pathways regulating pluripotency of stem cells
    120247089
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    120247089
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    120247089
   04613 Neutrophil extracellular trap formation
    120247089
   04620 Toll-like receptor signaling pathway
    120247089
   04625 C-type lectin receptor signaling pathway
    120247089
   04650 Natural killer cell mediated cytotoxicity
    120247089
   04660 T cell receptor signaling pathway
    120247089
   04662 B cell receptor signaling pathway
    120247089
   04664 Fc epsilon RI signaling pathway
    120247089
   04666 Fc gamma R-mediated phagocytosis
    120247089
   04670 Leukocyte transendothelial migration
    120247089
   04062 Chemokine signaling pathway
    120247089
  09152 Endocrine system
   04910 Insulin signaling pathway
    120247089
   04923 Regulation of lipolysis in adipocytes
    120247089
   04929 GnRH secretion
    120247089
   04915 Estrogen signaling pathway
    120247089
   04914 Progesterone-mediated oocyte maturation
    120247089
   04917 Prolactin signaling pathway
    120247089
   04926 Relaxin signaling pathway
    120247089
   04935 Growth hormone synthesis, secretion and action
    120247089
   04919 Thyroid hormone signaling pathway
    120247089
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    120247089
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    120247089
  09156 Nervous system
   04725 Cholinergic synapse
    120247089
   04722 Neurotrophin signaling pathway
    120247089
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    120247089
  09158 Development and regeneration
   04360 Axon guidance
    120247089
   04380 Osteoclast differentiation
    120247089
  09149 Aging
   04211 Longevity regulating pathway
    120247089
   04213 Longevity regulating pathway - multiple species
    120247089
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    120247089
   05206 MicroRNAs in cancer
    120247089
   05205 Proteoglycans in cancer
    120247089
   05207 Chemical carcinogenesis - receptor activation
    120247089
   05208 Chemical carcinogenesis - reactive oxygen species
    120247089
   05203 Viral carcinogenesis
    120247089
   05230 Central carbon metabolism in cancer
    120247089
   05231 Choline metabolism in cancer
    120247089
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    120247089
  09162 Cancer: specific types
   05210 Colorectal cancer
    120247089
   05212 Pancreatic cancer
    120247089
   05225 Hepatocellular carcinoma
    120247089
   05226 Gastric cancer
    120247089
   05214 Glioma
    120247089
   05221 Acute myeloid leukemia
    120247089
   05220 Chronic myeloid leukemia
    120247089
   05218 Melanoma
    120247089
   05211 Renal cell carcinoma
    120247089
   05215 Prostate cancer
    120247089
   05213 Endometrial cancer
    120247089
   05224 Breast cancer
    120247089
   05222 Small cell lung cancer
    120247089
   05223 Non-small cell lung cancer
    120247089
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    120247089
   05170 Human immunodeficiency virus 1 infection
    120247089
   05161 Hepatitis B
    120247089
   05160 Hepatitis C
    120247089
   05171 Coronavirus disease - COVID-19
    120247089
   05164 Influenza A
    120247089
   05162 Measles
    120247089
   05168 Herpes simplex virus 1 infection
    120247089
   05163 Human cytomegalovirus infection
    120247089
   05167 Kaposi sarcoma-associated herpesvirus infection
    120247089
   05169 Epstein-Barr virus infection
    120247089
   05165 Human papillomavirus infection
    120247089
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    120247089
   05100 Bacterial invasion of epithelial cells
    120247089
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    120247089
   05142 Chagas disease
    120247089
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    120247089
   05017 Spinocerebellar ataxia
    120247089
   05020 Prion disease
    120247089
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    120247089
   05418 Fluid shear stress and atherosclerosis
    120247089
   05415 Diabetic cardiomyopathy
    120247089
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    120247089
   04932 Non-alcoholic fatty liver disease
    120247089
   04931 Insulin resistance
    120247089
   04933 AGE-RAGE signaling pathway in diabetic complications
    120247089
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    120247089
   01524 Platinum drug resistance
    120247089
   01522 Endocrine resistance
    120247089
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hhv04131]
    120247089
Membrane trafficking [BR:hhv04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    120247089
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 SH2_1 Transcrip_act Exonuc_VII_L
Other DBs
NCBI-GeneID: 120247089
NCBI-ProteinID: XP_039110771
LinkDB
Position
Unknown
AA seq 417 aa
MTSAVTNGMKDSSVSLQDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTL
RKGGNNKLIKIYHRDGKYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQ
QDQLVKEDNIDAVGKKLQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIK
IFEEQCHTQEQHSKEYIERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQ
ALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADETYFIN
EEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHC
VIYSTARGYGFAEPYNLYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgacttcagctgttacaaatggaatgaaggacagttctgtttctcttcaggatgcagaa
tggtactggggggatatttcaagggaggaggtaaatgacaaattacgggatatgccagat
ggtacatttttggtcagagatgcttcaacaaaaatgcagggagattacaccttgactttg
cggaagggaggcaataataagttaataaagatctatcatcgcgatggtaaatacggcttt
tctgatcctctgacatttaattctgtggtggagctcattaaccactatcatcatgaatct
cttgctcagtacaatcccaaacttgatgtgaagctcatgtacccagtgtccagataccaa
caggatcaattggtaaaagaagataacatagatgcagtaggtaaaaaactccaagagtac
cattctcagtatcaggaaaagagtaaggagtatgacaggctatatgaggaatataccaga
acatcacaggaaatacagatgaagaggactgcaattgaagcttttaatgaaacaattaaa
atatttgaagagcagtgtcacacacaagaacaacatagcaaagaatatatcgagcgattt
cgtagagaggggaatgaaaaggaaattgaacgaattatgatgaattatgacaaattgaaa
tcacgtctgggtgagattcatgatagcaaaatgcgtctagagcaagatttgaagaaacaa
gctttggacaaccgagaaatagataaaaaaatgaacagtatcaaacctgacctgatccag
ctgcgcaagatccgagatcagcaccttgtatggctcaatcacaaaggagtcagacagaag
cgcctaaatgcctggctaggaatcaagaatgaggatgctgatgagacgtattttatcaat
gaggaagatgaaaacctgccccattatgatgagaaaacctggtttgttgaggatatcaat
cgagtacaagcagaggacttgctttatgggaaacctgatggtgcattcttaattcgtgag
agtagcaagaaaggatgttatgcttgctccgtggttgccgacggggaagtgaagcactgt
gtgatctacagcactgctcggggctacggcttcgcggagccctacaacctgtacagctcg
ctgaaggagctggtgctccattaccagcagacgtcccttgtccagcacaacgactccctc
aacgtcaggcttgcctaccctgtccacgcacagatgccctcgctctgcagataa

DBGET integrated database retrieval system