KEGG   Haloterrigena jeotgali: DVR14_20205
Entry
DVR14_20205       CDS       T05948                                 

Definition
(GenBank) NAD(P)-dependent oxidoreductase
  KO
K19660  L-arabinose 1-dehydrogenase [NAD(P)+] [EC:1.1.1.376]
Organism
hjt  Haloterrigena jeotgali
Pathway
hjt00053  Ascorbate and aldarate metabolism
hjt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hjt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    DVR14_20205
Enzymes [BR:hjt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.376  L-arabinose 1-dehydrogenase [NAD(P)+]
     DVR14_20205
SSDB
Motif
Pfam: Epimerase NAD_binding_4 3Beta_HSD Polysacc_synt_2 NAD_binding_10 RmlD_sub_bind GDP_Man_Dehyd DapB_N
Other DBs
NCBI-ProteinID: QCC60987
LinkDB
Position
unnamed6:complement(28112..28888)
AA seq 258 aa
MTNIAITGAAGNVGRVAIDAFPDDDHDLALFTHSETDDLESEPIEIADYDAFSDALAGQD
VLIHLAANPSPRVEWDEVREPNVDGVYNAFEAAAANDLERVVFASSNHAVNMKNTVSESR
PESTVGKPEIVRPSDPTDPDTYYGVTKVFGESMGSYYAKRHGFDVVNLRIGWLLTRDELR
AECRDRDGAGERYARAMWLSPGDCRRLLNAAATATLEESPLIAHGISDNAERFLSLSETM
QALSYRPQDDAEVVLTGD
NT seq 777 nt   +upstreamnt  +downstreamnt
atgacgaacatcgccatcaccggtgcggcgggcaacgtcggccgggtggccatcgacgcc
ttccccgacgacgaccacgacctcgcgctgttcacccacagcgagaccgacgacctcgag
tccgaaccgatcgagatcgccgattacgacgcgttcagcgacgcgctcgcgggtcaggac
gtcctgattcatctcgcggccaacccctccccgcgggtcgagtgggacgaggtacgcgaa
ccgaacgtcgacggcgtctacaacgccttcgaggcggcggccgcgaacgacctcgagcga
gtggtctttgcgagttcgaaccatgcggtcaacatgaaaaacaccgtctcggagagccgc
ccagagtcgacggtcggcaagccggagatcgtccggccgtcggatccgaccgatcccgac
acttactacggcgtcacgaaggtcttcggcgagtcgatggggtcctactacgcgaagcgc
cacgggttcgacgtagtgaacctccggatcggctggctgctcacccgcgacgaactccgc
gcggagtgccgtgaccgcgacggggccggcgagcgctacgcccgcgcgatgtggctcagc
cccggcgactgtcgacggctgctcaatgcggccgcgacggcgacgctcgaggagtccccc
ctgatcgcccacggcatctccgacaatgccgagcggttcctctcgctgtccgagaccatg
caggcgctgtcgtaccgaccgcaggacgacgccgaggtggtgctgaccggcgactag

DBGET integrated database retrieval system