Hydra vulgaris (swiftwater hydra): 100201768 Help Entry 100201768         CDS       T01080                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism hmg  Hydra vulgaris (swiftwater hydra) Pathway hmg00510   N-Glycan biosynthesis hmg00513   Various types of N-glycan biosynthesis hmg04141   Protein processing in endoplasmic reticulum Module hmg_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:hmg00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     100201768    00513 Various types of N-glycan biosynthesis     100201768  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100201768 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  100201768 NCBI-ProteinID:  XP_002164061 UniProt:  A0A8B6XPL3 LinkDB All DBs Position 2:complement(47497065..47499474) Genome browser AA seq 81 aa AA seqDB search MDIGIEQMSRYISPVNPVLYPHLTLILLGIGIFFTAWFFVYEVTSTKYTRDIYKELLVAF FAAIFMGFGTLFLLLWVGIYV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggatattggaattgaacagatgagtcgttatattagtcctgtaaatcctgttttatac cctcatttaactctaattcttctcggtattgggattttctttactgcttggttttttgtc tatgaagttacatcaacaaaatacacgagagatatttataaggaacttcttgtagcgttt tttgcagctatttttatgggttttggcacattatttttactgttatgggttggaatatat gtttga

DBGET integrated database retrieval system