Hylobates moloch (silvery gibbon): 116456218 Help Entry 116456218         CDS       T08803                                  Symbol FOS Name (RefSeq) protein c-Fos   KO K04379   proto-oncogene protein c-fos Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh01522   Endocrine resistance hmh04010   MAPK signaling pathway hmh04024   cAMP signaling pathway hmh04210   Apoptosis hmh04380   Osteoclast differentiation hmh04620   Toll-like receptor signaling pathway hmh04657   IL-17 signaling pathway hmh04658   Th1 and Th2 cell differentiation hmh04659   Th17 cell differentiation hmh04660   T cell receptor signaling pathway hmh04662   B cell receptor signaling pathway hmh04668   TNF signaling pathway hmh04713   Circadian entrainment hmh04725   Cholinergic synapse hmh04728   Dopaminergic synapse hmh04915   Estrogen signaling pathway hmh04917   Prolactin signaling pathway hmh04921   Oxytocin signaling pathway hmh04926   Relaxin signaling pathway hmh04928   Parathyroid hormone synthesis, secretion and action hmh04932   Non-alcoholic fatty liver disease hmh04935   Growth hormone synthesis, secretion and action hmh05031   Amphetamine addiction hmh05132   Salmonella infection hmh05133   Pertussis hmh05135   Yersinia infection hmh05140   Leishmaniasis hmh05142   Chagas disease hmh05161   Hepatitis B hmh05162   Measles hmh05166   Human T-cell leukemia virus 1 infection hmh05167   Kaposi sarcoma-associated herpesvirus infection hmh05170   Human immunodeficiency virus 1 infection hmh05171   Coronavirus disease - COVID-19 hmh05200   Pathways in cancer hmh05207   Chemical carcinogenesis - receptor activation hmh05208   Chemical carcinogenesis - reactive oxygen species hmh05210   Colorectal cancer hmh05224   Breast cancer hmh05231   Choline metabolism in cancer hmh05235   PD-L1 expression and PD-1 checkpoint pathway in cancer hmh05323   Rheumatoid arthritis hmh05417   Lipid and atherosclerosis hmh05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hmh00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116456218 (FOS)    04668 TNF signaling pathway     116456218 (FOS)    04024 cAMP signaling pathway     116456218 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     116456218 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     116456218 (FOS)    04660 T cell receptor signaling pathway     116456218 (FOS)    04658 Th1 and Th2 cell differentiation     116456218 (FOS)    04659 Th17 cell differentiation     116456218 (FOS)    04657 IL-17 signaling pathway     116456218 (FOS)    04662 B cell receptor signaling pathway     116456218 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     116456218 (FOS)    04917 Prolactin signaling pathway     116456218 (FOS)    04921 Oxytocin signaling pathway     116456218 (FOS)    04926 Relaxin signaling pathway     116456218 (FOS)    04935 Growth hormone synthesis, secretion and action     116456218 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     116456218 (FOS)   09156 Nervous system    04725 Cholinergic synapse     116456218 (FOS)    04728 Dopaminergic synapse     116456218 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     116456218 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     116456218 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116456218 (FOS)    05207 Chemical carcinogenesis - receptor activation     116456218 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     116456218 (FOS)    05231 Choline metabolism in cancer     116456218 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     116456218 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     116456218 (FOS)    05224 Breast cancer     116456218 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     116456218 (FOS)    05170 Human immunodeficiency virus 1 infection     116456218 (FOS)    05161 Hepatitis B     116456218 (FOS)    05171 Coronavirus disease - COVID-19     116456218 (FOS)    05162 Measles     116456218 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     116456218 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     116456218 (FOS)    05135 Yersinia infection     116456218 (FOS)    05133 Pertussis     116456218 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     116456218 (FOS)    05142 Chagas disease     116456218 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     116456218 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     116456218 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116456218 (FOS)    05418 Fluid shear stress and atherosclerosis     116456218 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     116456218 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     116456218 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:hmh03000]     116456218 (FOS)    04131 Membrane trafficking [BR:hmh04131]     116456218 (FOS) Transcription factors [BR:hmh03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     116456218 (FOS) Membrane trafficking [BR:hmh04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     116456218 (FOS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  116456218 NCBI-ProteinID:  XP_031990763 LinkDB All DBs Position Unknown AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSASF IPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPTPSAGAYSRAGVVKTMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFT LPLLNDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPTGSETARSVPDMDLSGSFYA ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctcgggcttcaacgcagactacgaggcgtcatcctcccgctgcagcagcgcg tccccggccggggatagcctctcctactaccactcacccgctgactccttctccagcatg ggctcgcctgtcaacgcgcaggacttctgcacggacctggccgtctccagtgccagcttc attcccacggtcactgccatctcgaccagtccggacctgcagtggctggtgcagcccgcc ctcgtctcctctgtggccccatcgcagaccagagcccctcaccctttcggagtccccact ccctccgctggggcttactccagggctggcgttgtgaagaccatgacaggaggccgagcg cagagcattggcaggaggggcaaggtggaacagttatctccagaagaagaagagaaaagg agaatccgaagggaaaggaataagatggctgcagccaaatgccgcaaccggaggagggag ctgactgatacactccaagcggagacagaccaactagaagatgagaagtctgctttgcag accgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcagctcac cgacctgcctgcaagatccctgatgacctgggcttcccagaagagatgtctgtggcttcc cttgatctgactgggggcctgccagaggtcgccaccccggagtctgaggaggccttcacc ctgcctctcctcaatgaccctgagcccaagccctcagtggaacctgtcaagagcatcagc agcatggagctgaaggccgagcccttcgatgacttcctgttcccagcatcatccaggccc accggctctgagacagcccgctccgtgccagacatggacctatctgggtccttctatgca gcagactgggagcccctgcacagtggctccctggggatggggcccatggccacagagctg gagcccctgtgcactccggtggtcacgtgtactcccagctgcactgcttacacgtcttcc ttcgtcttcacctaccccgaggctgactccttccccagctgcgcagctgcccaccgcaag ggcagcagcagcaacgagccctcctctgactcgctcagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system