Hylobates moloch (silvery gibbon): 116458843 Help Entry 116458843         CDS       T08803                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04060   Cytokine-cytokine receptor interaction hmh04151   PI3K-Akt signaling pathway hmh04217   Necroptosis hmh04380   Osteoclast differentiation hmh04620   Toll-like receptor signaling pathway hmh04621   NOD-like receptor signaling pathway hmh04622   RIG-I-like receptor signaling pathway hmh04623   Cytosolic DNA-sensing pathway hmh04630   JAK-STAT signaling pathway hmh04650   Natural killer cell mediated cytotoxicity hmh04668   TNF signaling pathway hmh04936   Alcoholic liver disease hmh05135   Yersinia infection hmh05142   Chagas disease hmh05152   Tuberculosis hmh05160   Hepatitis C hmh05161   Hepatitis B hmh05162   Measles hmh05163   Human cytomegalovirus infection hmh05164   Influenza A hmh05165   Human papillomavirus infection hmh05167   Kaposi sarcoma-associated herpesvirus infection hmh05168   Herpes simplex virus 1 infection hmh05169   Epstein-Barr virus infection hmh05170   Human immunodeficiency virus 1 infection hmh05171   Coronavirus disease - COVID-19 hmh05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hmh00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     116458843 (IFNB1)    04668 TNF signaling pathway     116458843 (IFNB1)    04151 PI3K-Akt signaling pathway     116458843 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     116458843 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     116458843 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     116458843 (IFNB1)    04621 NOD-like receptor signaling pathway     116458843 (IFNB1)    04622 RIG-I-like receptor signaling pathway     116458843 (IFNB1)    04623 Cytosolic DNA-sensing pathway     116458843 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     116458843 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     116458843 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     116458843 (IFNB1)    05161 Hepatitis B     116458843 (IFNB1)    05160 Hepatitis C     116458843 (IFNB1)    05171 Coronavirus disease - COVID-19     116458843 (IFNB1)    05164 Influenza A     116458843 (IFNB1)    05162 Measles     116458843 (IFNB1)    05168 Herpes simplex virus 1 infection     116458843 (IFNB1)    05163 Human cytomegalovirus infection     116458843 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     116458843 (IFNB1)    05169 Epstein-Barr virus infection     116458843 (IFNB1)    05165 Human papillomavirus infection     116458843 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     116458843 (IFNB1)    05152 Tuberculosis     116458843 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     116458843 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116458843 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     116458843 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hmh04052]     116458843 (IFNB1) Cytokines and neuropeptides [BR:hmh04052]  Cytokines   Interferons    116458843 (IFNB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Tat Motif Other DBs NCBI-GeneID:  116458843 NCBI-ProteinID:  XP_031994782 LinkDB All DBs Position Unknown AA seq 187 aa AA seqDB search MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRRSSFQCQKLLWQLNGRLEYCLKDRMNFD IPEEIKQLQQFQKEDAALTIYEMLQNIFAVFRQDLSSTGWNETIVENLLANVYHQIDHLK TVLEEKLEKEDFTRGKFMSSLHLKRYYGRILHYLKAKEYSHCAWTVVRVEILRNFFFINR LTGYLRN NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgaccaacaagtgtctcctccaaattgctctcctgttgtgcttctccactacagctctt tccatgagctacaacttgcttggattcctacaaagaaggagtagttttcagtgtcagaag ctcctgtggcaattgaatgggaggcttgaatattgcctcaaggacaggatgaactttgac atccctgaggagataaagcagctgcagcagttccagaaggaggacgctgcactgactatc tatgagatgctccagaacatctttgctgttttcagacaagatttatctagcactggctgg aatgagactattgttgagaacctccttgctaatgtctatcatcagatagaccatctgaag acagtcctggaagagaaactggagaaagaagatttcaccaggggaaaattcatgagcagt ctgcacctgaaaagatattatgggaggattctgcattacctgaaggccaaggagtacagt cactgtgcctggactgtagtcagagtggaaatcctcaggaactttttctttattaacaga cttacaggttacctccgaaactga

DBGET integrated database retrieval system