Hylobates moloch (silvery gibbon): 116460115 Help Entry 116460115         CDS       T08803                                  Symbol TNF Name (RefSeq) tumor necrosis factor isoform X2   KO K03156   tumor necrosis factor superfamily, member 2 Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh01523   Antifolate resistance hmh04010   MAPK signaling pathway hmh04060   Cytokine-cytokine receptor interaction hmh04061   Viral protein interaction with cytokine and cytokine receptor hmh04064   NF-kappa B signaling pathway hmh04071   Sphingolipid signaling pathway hmh04150   mTOR signaling pathway hmh04210   Apoptosis hmh04217   Necroptosis hmh04350   TGF-beta signaling pathway hmh04380   Osteoclast differentiation hmh04612   Antigen processing and presentation hmh04620   Toll-like receptor signaling pathway hmh04621   NOD-like receptor signaling pathway hmh04622   RIG-I-like receptor signaling pathway hmh04625   C-type lectin receptor signaling pathway hmh04640   Hematopoietic cell lineage hmh04650   Natural killer cell mediated cytotoxicity hmh04657   IL-17 signaling pathway hmh04660   T cell receptor signaling pathway hmh04664   Fc epsilon RI signaling pathway hmh04668   TNF signaling pathway hmh04920   Adipocytokine signaling pathway hmh04930   Type II diabetes mellitus hmh04931   Insulin resistance hmh04932   Non-alcoholic fatty liver disease hmh04933   AGE-RAGE signaling pathway in diabetic complications hmh04936   Alcoholic liver disease hmh04940   Type I diabetes mellitus hmh05010   Alzheimer disease hmh05014   Amyotrophic lateral sclerosis hmh05020   Prion disease hmh05022   Pathways of neurodegeneration - multiple diseases hmh05132   Salmonella infection hmh05133   Pertussis hmh05134   Legionellosis hmh05135   Yersinia infection hmh05140   Leishmaniasis hmh05142   Chagas disease hmh05143   African trypanosomiasis hmh05144   Malaria hmh05145   Toxoplasmosis hmh05146   Amoebiasis hmh05152   Tuberculosis hmh05160   Hepatitis C hmh05161   Hepatitis B hmh05163   Human cytomegalovirus infection hmh05164   Influenza A hmh05165   Human papillomavirus infection hmh05166   Human T-cell leukemia virus 1 infection hmh05168   Herpes simplex virus 1 infection hmh05169   Epstein-Barr virus infection hmh05170   Human immunodeficiency virus 1 infection hmh05171   Coronavirus disease - COVID-19 hmh05205   Proteoglycans in cancer hmh05310   Asthma hmh05321   Inflammatory bowel disease hmh05322   Systemic lupus erythematosus hmh05323   Rheumatoid arthritis hmh05330   Allograft rejection hmh05332   Graft-versus-host disease hmh05410   Hypertrophic cardiomyopathy hmh05414   Dilated cardiomyopathy hmh05417   Lipid and atherosclerosis hmh05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hmh00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116460115 (TNF)    04350 TGF-beta signaling pathway     116460115 (TNF)    04064 NF-kappa B signaling pathway     116460115 (TNF)    04668 TNF signaling pathway     116460115 (TNF)    04071 Sphingolipid signaling pathway     116460115 (TNF)    04150 mTOR signaling pathway     116460115 (TNF)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     116460115 (TNF)    04061 Viral protein interaction with cytokine and cytokine receptor     116460115 (TNF)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     116460115 (TNF)    04217 Necroptosis     116460115 (TNF)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     116460115 (TNF)    04620 Toll-like receptor signaling pathway     116460115 (TNF)    04621 NOD-like receptor signaling pathway     116460115 (TNF)    04622 RIG-I-like receptor signaling pathway     116460115 (TNF)    04625 C-type lectin receptor signaling pathway     116460115 (TNF)    04650 Natural killer cell mediated cytotoxicity     116460115 (TNF)    04612 Antigen processing and presentation     116460115 (TNF)    04660 T cell receptor signaling pathway     116460115 (TNF)    04657 IL-17 signaling pathway     116460115 (TNF)    04664 Fc epsilon RI signaling pathway     116460115 (TNF)   09152 Endocrine system    04920 Adipocytokine signaling pathway     116460115 (TNF)   09158 Development and regeneration    04380 Osteoclast differentiation     116460115 (TNF)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     116460115 (TNF)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     116460115 (TNF)    05170 Human immunodeficiency virus 1 infection     116460115 (TNF)    05161 Hepatitis B     116460115 (TNF)    05160 Hepatitis C     116460115 (TNF)    05171 Coronavirus disease - COVID-19     116460115 (TNF)    05164 Influenza A     116460115 (TNF)    05168 Herpes simplex virus 1 infection     116460115 (TNF)    05163 Human cytomegalovirus infection     116460115 (TNF)    05169 Epstein-Barr virus infection     116460115 (TNF)    05165 Human papillomavirus infection     116460115 (TNF)   09171 Infectious disease: bacterial    05132 Salmonella infection     116460115 (TNF)    05135 Yersinia infection     116460115 (TNF)    05133 Pertussis     116460115 (TNF)    05134 Legionellosis     116460115 (TNF)    05152 Tuberculosis     116460115 (TNF)   09174 Infectious disease: parasitic    05146 Amoebiasis     116460115 (TNF)    05144 Malaria     116460115 (TNF)    05145 Toxoplasmosis     116460115 (TNF)    05140 Leishmaniasis     116460115 (TNF)    05142 Chagas disease     116460115 (TNF)    05143 African trypanosomiasis     116460115 (TNF)   09163 Immune disease    05310 Asthma     116460115 (TNF)    05322 Systemic lupus erythematosus     116460115 (TNF)    05323 Rheumatoid arthritis     116460115 (TNF)    05321 Inflammatory bowel disease     116460115 (TNF)    05330 Allograft rejection     116460115 (TNF)    05332 Graft-versus-host disease     116460115 (TNF)   09164 Neurodegenerative disease    05010 Alzheimer disease     116460115 (TNF)    05014 Amyotrophic lateral sclerosis     116460115 (TNF)    05020 Prion disease     116460115 (TNF)    05022 Pathways of neurodegeneration - multiple diseases     116460115 (TNF)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116460115 (TNF)    05418 Fluid shear stress and atherosclerosis     116460115 (TNF)    05410 Hypertrophic cardiomyopathy     116460115 (TNF)    05414 Dilated cardiomyopathy     116460115 (TNF)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     116460115 (TNF)    04940 Type I diabetes mellitus     116460115 (TNF)    04936 Alcoholic liver disease     116460115 (TNF)    04932 Non-alcoholic fatty liver disease     116460115 (TNF)    04931 Insulin resistance     116460115 (TNF)    04933 AGE-RAGE signaling pathway in diabetic complications     116460115 (TNF)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     116460115 (TNF)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hmh04052]     116460115 (TNF)    00536 Glycosaminoglycan binding proteins [BR:hmh00536]     116460115 (TNF) Cytokines and neuropeptides [BR:hmh04052]  Cytokines   Tumor necrosis fators    116460115 (TNF) Glycosaminoglycan binding proteins [BR:hmh00536]  Heparan sulfate / Heparin   Cytokines    116460115 (TNF) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  116460115 NCBI-ProteinID:  XP_031996909 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSTESMIRDVELAEEALPKKTGGPQGSRRCFLLSLFSFLLVAGATTLFCLLHFGVIGPQR EEFPKDLPLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELT GNQLVVPSEGLYLIYSQVLFKGQGCPPTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgagcactgaaagcatgatccgggacgtggagctggccgaggaggcgctccccaagaag acaggggggccccagggctccaggcggtgctttctcctcagcctcttctccttcctgctc gtggcaggcgccaccacgctcttctgcctgctgcactttggagtgatcggcccacagagg gaagagttccccaaggacctccctctaatcagccctctggcccaggcagtcagatcatct tctcgaaccccgagtgacaagcctgtagcccatgttgtagcaaaccctcaagctgagggg cagctccagtggctgaaccgccgggccaatgccctcctggccaatggcgtggagctgaca ggtaaccagctggtggtgccatcagagggcctgtacctcatctactcccaggtcctcttc aagggccaaggctgcccccccacccatgtgctcctcacccacaccatcagccgcatcgcc gtctcctaccagaccaaggtcaatctcctctctgccatcaagagcccctgccagagggag accccagagggggctgaggccaagccctggtatgagcccatctatctgggaggggtattc cagctggagaagggtgatcgactcagcgctgagatcaatcggcctgactatctcgacttt gccgagtctgggcaggtctacttcgggatcattgccctgtga

DBGET integrated database retrieval system