Hylobates moloch (silvery gibbon): 116468493 Help Entry 116468493         CDS       T08803                                  Symbol BCL2 Name (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh01521   EGFR tyrosine kinase inhibitor resistance hmh01522   Endocrine resistance hmh01524   Platinum drug resistance hmh04064   NF-kappa B signaling pathway hmh04066   HIF-1 signaling pathway hmh04071   Sphingolipid signaling pathway hmh04115   p53 signaling pathway hmh04140   Autophagy - animal hmh04141   Protein processing in endoplasmic reticulum hmh04151   PI3K-Akt signaling pathway hmh04210   Apoptosis hmh04215   Apoptosis - multiple species hmh04217   Necroptosis hmh04261   Adrenergic signaling in cardiomyocytes hmh04340   Hedgehog signaling pathway hmh04510   Focal adhesion hmh04621   NOD-like receptor signaling pathway hmh04630   JAK-STAT signaling pathway hmh04722   Neurotrophin signaling pathway hmh04725   Cholinergic synapse hmh04915   Estrogen signaling pathway hmh04928   Parathyroid hormone synthesis, secretion and action hmh04933   AGE-RAGE signaling pathway in diabetic complications hmh05014   Amyotrophic lateral sclerosis hmh05022   Pathways of neurodegeneration - multiple diseases hmh05132   Salmonella infection hmh05145   Toxoplasmosis hmh05152   Tuberculosis hmh05161   Hepatitis B hmh05162   Measles hmh05168   Herpes simplex virus 1 infection hmh05169   Epstein-Barr virus infection hmh05170   Human immunodeficiency virus 1 infection hmh05200   Pathways in cancer hmh05206   MicroRNAs in cancer hmh05207   Chemical carcinogenesis - receptor activation hmh05210   Colorectal cancer hmh05215   Prostate cancer hmh05222   Small cell lung cancer hmh05226   Gastric cancer hmh05417   Lipid and atherosclerosis hmh05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hmh00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     116468493 (BCL2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     116468493 (BCL2)    04630 JAK-STAT signaling pathway     116468493 (BCL2)    04064 NF-kappa B signaling pathway     116468493 (BCL2)    04066 HIF-1 signaling pathway     116468493 (BCL2)    04071 Sphingolipid signaling pathway     116468493 (BCL2)    04151 PI3K-Akt signaling pathway     116468493 (BCL2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     116468493 (BCL2)   09143 Cell growth and death    04210 Apoptosis     116468493 (BCL2)    04215 Apoptosis - multiple species     116468493 (BCL2)    04217 Necroptosis     116468493 (BCL2)    04115 p53 signaling pathway     116468493 (BCL2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     116468493 (BCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     116468493 (BCL2)   09152 Endocrine system    04915 Estrogen signaling pathway     116468493 (BCL2)    04928 Parathyroid hormone synthesis, secretion and action     116468493 (BCL2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     116468493 (BCL2)   09156 Nervous system    04725 Cholinergic synapse     116468493 (BCL2)    04722 Neurotrophin signaling pathway     116468493 (BCL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116468493 (BCL2)    05206 MicroRNAs in cancer     116468493 (BCL2)    05207 Chemical carcinogenesis - receptor activation     116468493 (BCL2)   09162 Cancer: specific types    05210 Colorectal cancer     116468493 (BCL2)    05226 Gastric cancer     116468493 (BCL2)    05215 Prostate cancer     116468493 (BCL2)    05222 Small cell lung cancer     116468493 (BCL2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     116468493 (BCL2)    05161 Hepatitis B     116468493 (BCL2)    05162 Measles     116468493 (BCL2)    05168 Herpes simplex virus 1 infection     116468493 (BCL2)    05169 Epstein-Barr virus infection     116468493 (BCL2)   09171 Infectious disease: bacterial    05132 Salmonella infection     116468493 (BCL2)    05152 Tuberculosis     116468493 (BCL2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     116468493 (BCL2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     116468493 (BCL2)    05022 Pathways of neurodegeneration - multiple diseases     116468493 (BCL2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116468493 (BCL2)    05418 Fluid shear stress and atherosclerosis     116468493 (BCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     116468493 (BCL2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     116468493 (BCL2)    01524 Platinum drug resistance     116468493 (BCL2)    01522 Endocrine resistance     116468493 (BCL2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:hmh01009]     116468493 (BCL2) Protein phosphatases and associated proteins [BR:hmh01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      116468493 (BCL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 ARMH5 Motif Other DBs NCBI-GeneID:  116468493 NCBI-ProteinID:  XP_032007997 LinkDB All DBs Position Unknown AA seq 239 aa AA seqDB search MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA ASRDPVARTSPLPTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIAMWMTEY LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK NT seq 720 nt NT seq  +upstreamnt  +downstreamnt atggcgcacgctgggagaacagggtacgataaccgggagatagtgatgaagtacatccat tataagctgtcgcagaggggctacgagtgggatgcgggagatgtgggcgccgcgcccccg ggggccgcccccgcaccgggcatcttctcctcccagccggggcacacgccccatccagcc gcatcccgggatccggtcgccaggacctcgccgctgccgaccccggctgcccccggcgcc gccgcggggcctgcgctcagcccggtgccacctgtggtccacctgaccctccgccaggcc ggcgacgacttctcccgccgctaccgccgcgacttcgccgagatgtccagccagctgcac ctgacgcccttcaccgcgcggggacgctttgccacggtggtggaggagctcttcagggac ggggtgaactgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggag agcgtcaaccgggagatgtcgcccctggtggacaacatcgccatgtggatgactgagtac ctgaaccggcacctgcacacctggatccaggataacggaggctgggatgcctttgtggaa ctgtacggccccagcatgcggcctctgtttgatttctcctggctgtctctgaagactctg ctcagtttggccctggtgggagcttgcatcaccctgggtgcctatctgggccacaagtga

DBGET integrated database retrieval system