Hylobates moloch (silvery gibbon): 116475080 Help Entry 116475080         CDS       T08803                                  Name (RefSeq) C-X-C motif chemokine 3   KO K05505   C-X-C motif chemokine 1/2/3 Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04060   Cytokine-cytokine receptor interaction hmh04061   Viral protein interaction with cytokine and cytokine receptor hmh04062   Chemokine signaling pathway hmh04064   NF-kappa B signaling pathway hmh04621   NOD-like receptor signaling pathway hmh04657   IL-17 signaling pathway hmh04668   TNF signaling pathway hmh04936   Alcoholic liver disease hmh05134   Legionellosis hmh05146   Amoebiasis hmh05167   Kaposi sarcoma-associated herpesvirus infection hmh05323   Rheumatoid arthritis hmh05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hmh00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     116475080    04668 TNF signaling pathway     116475080   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     116475080    04061 Viral protein interaction with cytokine and cytokine receptor     116475080  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     116475080    04657 IL-17 signaling pathway     116475080    04062 Chemokine signaling pathway     116475080  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     116475080   09171 Infectious disease: bacterial    05134 Legionellosis     116475080   09174 Infectious disease: parasitic    05146 Amoebiasis     116475080   09163 Immune disease    05323 Rheumatoid arthritis     116475080   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116475080   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     116475080  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hmh04052]     116475080 Cytokines and neuropeptides [BR:hmh04052]  Cytokines   Chemokines    116475080 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Lenti_VIF_2 Motif Other DBs NCBI-GeneID:  116475080 NCBI-ProteinID:  XP_032020021 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MAHTALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVVTELRCQCLQTLHGIHLKNIQSV NVKSPGPHCAQTEVIATLKNGQKACLNPASLMVKKIIEKILNKGSTN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggcccacaccgcgctctccgcagcccccagcaatccccggctcctgcgggtggcgctg ctgctcctgcttctggtggccgccggccggcgcgcagcaggagcgtccgtggtcactgaa ctgcgctgccagtgcttgcagacactgcacggaattcacctcaagaacatccaaagtgtg aacgtgaagtccccaggaccccactgcgcccaaaccgaagtcatagccacactcaagaat gggcagaaagcttgtctcaaccccgcatccctcatggttaagaaaatcatcgaaaagata ttgaacaaggggagcaccaactga

DBGET integrated database retrieval system