Hylobates moloch (silvery gibbon): 116476942 Help Entry 116476942         CDS       T08803                                  Symbol IL18 Name (RefSeq) interleukin-18   KO K05482   interleukin 18 Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04060   Cytokine-cytokine receptor interaction hmh04061   Viral protein interaction with cytokine and cytokine receptor hmh04621   NOD-like receptor signaling pathway hmh04623   Cytosolic DNA-sensing pathway hmh05132   Salmonella infection hmh05134   Legionellosis hmh05135   Yersinia infection hmh05143   African trypanosomiasis hmh05144   Malaria hmh05152   Tuberculosis hmh05164   Influenza A hmh05321   Inflammatory bowel disease hmh05323   Rheumatoid arthritis hmh05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hmh00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     116476942 (IL18)    04061 Viral protein interaction with cytokine and cytokine receptor     116476942 (IL18)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     116476942 (IL18)    04623 Cytosolic DNA-sensing pathway     116476942 (IL18)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     116476942 (IL18)   09171 Infectious disease: bacterial    05132 Salmonella infection     116476942 (IL18)    05135 Yersinia infection     116476942 (IL18)    05134 Legionellosis     116476942 (IL18)    05152 Tuberculosis     116476942 (IL18)   09174 Infectious disease: parasitic    05144 Malaria     116476942 (IL18)    05143 African trypanosomiasis     116476942 (IL18)   09163 Immune disease    05323 Rheumatoid arthritis     116476942 (IL18)    05321 Inflammatory bowel disease     116476942 (IL18)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116476942 (IL18)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hmh04052]     116476942 (IL18) Cytokines and neuropeptides [BR:hmh04052]  Cytokines   Interleukins    116476942 (IL18) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 Motif Other DBs NCBI-GeneID:  116476942 NCBI-ProteinID:  XP_032023282 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFRKMESKLSIIRNLNDQVLFIDQ GNRPLFEDMTDSDCRDNAPRTVFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFK EMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKKDEL GDRSIMFTVQNED NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgctgaaccagtagaagacaattgcatcaactttgtggcaatgaaatttattgac aatacgctttactttatagctgaagatgatgaaaacctggaatcagattactttcgcaag atggaatctaaattatcaatcataagaaatttgaatgaccaagttctcttcattgaccaa ggaaatcggcccctatttgaagatatgactgattctgactgtagagataatgcaccccgg accgtatttattataagtatgtataaagacagccagcctagaggtatggctgtaaccatc tctgtgaagtgtgagaaaatttcaactctctcctgtgagaacaaaattatttcctttaag gaaatgaatcctcctgataacatcaaggacacaaaaagcgacatcatattctttcagaga agtgtcccaggacatgataataagatgcaatttgaatcttcatcatacgaaggatacttt ctagcttgtgaaaaagagagagacctttttaaactcattttgaaaaaaaaggatgaattg ggggatagatctataatgttcactgttcaaaacgaagactag

DBGET integrated database retrieval system