Hylobates moloch (silvery gibbon): 116478979 Help Entry 116478979         CDS       T08803                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04010   MAPK signaling pathway hmh04014   Ras signaling pathway hmh04015   Rap1 signaling pathway hmh04024   cAMP signaling pathway hmh04062   Chemokine signaling pathway hmh04510   Focal adhesion hmh04517   IgSF CAM signaling hmh04520   Adherens junction hmh04611   Platelet activation hmh04670   Leukocyte transendothelial migration hmh04720   Long-term potentiation hmh04722   Neurotrophin signaling pathway hmh04934   Cushing syndrome hmh04972   Pancreatic secretion hmh05211   Renal cell carcinoma hmh05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hmh00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116478979 (RAP1B)    04014 Ras signaling pathway     116478979 (RAP1B)    04015 Rap1 signaling pathway     116478979 (RAP1B)    04024 cAMP signaling pathway     116478979 (RAP1B)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     116478979 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     116478979 (RAP1B)    04520 Adherens junction     116478979 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     116478979 (RAP1B)    04670 Leukocyte transendothelial migration     116478979 (RAP1B)    04062 Chemokine signaling pathway     116478979 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     116478979 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     116478979 (RAP1B)    04722 Neurotrophin signaling pathway     116478979 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     116478979 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116478979 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     116478979 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hmh04147]     116478979 (RAP1B)    04031 GTP-binding proteins [BR:hmh04031]     116478979 (RAP1B) Exosome [BR:hmh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    116478979 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    116478979 (RAP1B)   Exosomal proteins of colorectal cancer cells    116478979 (RAP1B) GTP-binding proteins [BR:hmh04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     116478979 (RAP1B) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  116478979 NCBI-ProteinID:  XP_032026581 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctcaggaggcgttggaaagtctgctttgact gtacaatttgttcaaggaatttttgtagaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggaacaatttacagcaatgagggatttgtacatgaaaaatggacaaggatttgcatta gtttattccatcacagcacagtccacatttaatgatttacaagacctgagagaacagatt cttcgagttaaagacactgatgatgttccaatgattcttgttggtaataagtgtgacttg gaagatgaaagagttgtagggaaggaacaaggtcaaaatctagcaagacaatggaacaac tgtgcattcttagaatcttctgcaaaatccaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaaggctcgcaaaaagtcatca tgtcagttgctttaa

DBGET integrated database retrieval system