Hylobates moloch (silvery gibbon): 116812933 Help Entry 116812933         CDS       T08803                                  Symbol NPPA Name (RefSeq) natriuretic peptides A   KO K12334   natriuretic peptide A Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04022   cGMP-PKG signaling pathway hmh04024   cAMP signaling pathway hmh04066   HIF-1 signaling pathway hmh04081   Hormone signaling hmh04270   Vascular smooth muscle contraction hmh04714   Thermogenesis hmh04921   Oxytocin signaling pathway hmh04923   Regulation of lipolysis in adipocytes hmh04924   Renin secretion hmh04925   Aldosterone synthesis and secretion hmh05143   African trypanosomiasis Brite KEGG Orthology (KO) [BR:hmh00001]  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     116812933 (NPPA)    04024 cAMP signaling pathway     116812933 (NPPA)    04022 cGMP-PKG signaling pathway     116812933 (NPPA)   09133 Signaling molecules and interaction    04081 Hormone signaling     116812933 (NPPA)  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     116812933 (NPPA)    04921 Oxytocin signaling pathway     116812933 (NPPA)    04924 Renin secretion     116812933 (NPPA)    04925 Aldosterone synthesis and secretion     116812933 (NPPA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     116812933 (NPPA)   09159 Environmental adaptation    04714 Thermogenesis     116812933 (NPPA)  09160 Human Diseases   09174 Infectious disease: parasitic    05143 African trypanosomiasis     116812933 (NPPA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hmh04052]     116812933 (NPPA) Cytokines and neuropeptides [BR:hmh04052]  Neuropeptides   Unclassified    116812933 (NPPA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  116812933 NCBI-ProteinID:  XP_032614839 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MSSFSTITVSFLLFLAFQLLGQTRANPVYNAVSNADLMDFKNLLDNLEEKMPLEDEFVPP QMLSEQNEEAGAALSPLPEVPPWTREVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLT APRSLRRSSCFGGRMDRIGAQSGLGCNSFRYRR NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgagctccttctccaccatcactgtgagcttcctcctttttctggcattccagctccta ggtcagaccagagctaatcccgtgtataatgccgtgtccaacgcagacctgatggatttc aagaatttgctggacaatttggaagaaaagatgcctttagaagatgagttcgtgccccca caaatgctcagtgagcagaatgaagaagcgggggctgctctcagccccctccctgaggtg cctccctggaccagggaagtcagcccagcccagagagatgggggtgccctcgggcggggc ccctgggactcctctgatcgatctgccctcctaaaaagcaagctgagggcgctgctcact gcccctcggagcctgcggagatccagctgcttcgggggcaggatggacaggattggagcc cagagtggactgggctgtaacagcttccggtaccgaagataa

DBGET integrated database retrieval system