KEGG   Hylobates moloch (silvery gibbon): 116814342
Entry
116814342         CDS       T08803                                 
Name
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2-like
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
hmh  Hylobates moloch (silvery gibbon)
Pathway
hmh01521  EGFR tyrosine kinase inhibitor resistance
hmh01522  Endocrine resistance
hmh04010  MAPK signaling pathway
hmh04012  ErbB signaling pathway
hmh04014  Ras signaling pathway
hmh04015  Rap1 signaling pathway
hmh04022  cGMP-PKG signaling pathway
hmh04024  cAMP signaling pathway
hmh04066  HIF-1 signaling pathway
hmh04068  FoxO signaling pathway
hmh04071  Sphingolipid signaling pathway
hmh04072  Phospholipase D signaling pathway
hmh04140  Autophagy - animal
hmh04148  Efferocytosis
hmh04150  mTOR signaling pathway
hmh04151  PI3K-Akt signaling pathway
hmh04210  Apoptosis
hmh04218  Cellular senescence
hmh04270  Vascular smooth muscle contraction
hmh04370  VEGF signaling pathway
hmh04371  Apelin signaling pathway
hmh04517  IgSF CAM signaling
hmh04540  Gap junction
hmh04550  Signaling pathways regulating pluripotency of stem cells
hmh04613  Neutrophil extracellular trap formation
hmh04620  Toll-like receptor signaling pathway
hmh04650  Natural killer cell mediated cytotoxicity
hmh04660  T cell receptor signaling pathway
hmh04662  B cell receptor signaling pathway
hmh04664  Fc epsilon RI signaling pathway
hmh04720  Long-term potentiation
hmh04722  Neurotrophin signaling pathway
hmh04730  Long-term depression
hmh04810  Regulation of actin cytoskeleton
hmh04910  Insulin signaling pathway
hmh04912  GnRH signaling pathway
hmh04915  Estrogen signaling pathway
hmh04916  Melanogenesis
hmh04917  Prolactin signaling pathway
hmh04919  Thyroid hormone signaling pathway
hmh04921  Oxytocin signaling pathway
hmh04926  Relaxin signaling pathway
hmh04929  GnRH secretion
hmh04934  Cushing syndrome
hmh04935  Growth hormone synthesis, secretion and action
hmh05010  Alzheimer disease
hmh05022  Pathways of neurodegeneration - multiple diseases
hmh05132  Salmonella infection
hmh05135  Yersinia infection
hmh05160  Hepatitis C
hmh05161  Hepatitis B
hmh05163  Human cytomegalovirus infection
hmh05164  Influenza A
hmh05165  Human papillomavirus infection
hmh05166  Human T-cell leukemia virus 1 infection
hmh05167  Kaposi sarcoma-associated herpesvirus infection
hmh05170  Human immunodeficiency virus 1 infection
hmh05200  Pathways in cancer
hmh05205  Proteoglycans in cancer
hmh05206  MicroRNAs in cancer
hmh05207  Chemical carcinogenesis - receptor activation
hmh05208  Chemical carcinogenesis - reactive oxygen species
hmh05210  Colorectal cancer
hmh05211  Renal cell carcinoma
hmh05213  Endometrial cancer
hmh05214  Glioma
hmh05215  Prostate cancer
hmh05216  Thyroid cancer
hmh05218  Melanoma
hmh05219  Bladder cancer
hmh05220  Chronic myeloid leukemia
hmh05221  Acute myeloid leukemia
hmh05223  Non-small cell lung cancer
hmh05224  Breast cancer
hmh05225  Hepatocellular carcinoma
hmh05226  Gastric cancer
hmh05230  Central carbon metabolism in cancer
hmh05231  Choline metabolism in cancer
hmh05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hmh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    116814342
   04012 ErbB signaling pathway
    116814342
   04014 Ras signaling pathway
    116814342
   04015 Rap1 signaling pathway
    116814342
   04370 VEGF signaling pathway
    116814342
   04371 Apelin signaling pathway
    116814342
   04066 HIF-1 signaling pathway
    116814342
   04068 FoxO signaling pathway
    116814342
   04072 Phospholipase D signaling pathway
    116814342
   04071 Sphingolipid signaling pathway
    116814342
   04024 cAMP signaling pathway
    116814342
   04022 cGMP-PKG signaling pathway
    116814342
   04151 PI3K-Akt signaling pathway
    116814342
   04150 mTOR signaling pathway
    116814342
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    116814342
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    116814342
   04148 Efferocytosis
    116814342
  09143 Cell growth and death
   04210 Apoptosis
    116814342
   04218 Cellular senescence
    116814342
  09144 Cellular community - eukaryotes
   04540 Gap junction
    116814342
   04550 Signaling pathways regulating pluripotency of stem cells
    116814342
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    116814342
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    116814342
   04620 Toll-like receptor signaling pathway
    116814342
   04650 Natural killer cell mediated cytotoxicity
    116814342
   04660 T cell receptor signaling pathway
    116814342
   04662 B cell receptor signaling pathway
    116814342
   04664 Fc epsilon RI signaling pathway
    116814342
  09152 Endocrine system
   04910 Insulin signaling pathway
    116814342
   04929 GnRH secretion
    116814342
   04912 GnRH signaling pathway
    116814342
   04915 Estrogen signaling pathway
    116814342
   04917 Prolactin signaling pathway
    116814342
   04921 Oxytocin signaling pathway
    116814342
   04926 Relaxin signaling pathway
    116814342
   04935 Growth hormone synthesis, secretion and action
    116814342
   04919 Thyroid hormone signaling pathway
    116814342
   04916 Melanogenesis
    116814342
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    116814342
  09156 Nervous system
   04720 Long-term potentiation
    116814342
   04730 Long-term depression
    116814342
   04722 Neurotrophin signaling pathway
    116814342
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    116814342
   05206 MicroRNAs in cancer
    116814342
   05205 Proteoglycans in cancer
    116814342
   05207 Chemical carcinogenesis - receptor activation
    116814342
   05208 Chemical carcinogenesis - reactive oxygen species
    116814342
   05230 Central carbon metabolism in cancer
    116814342
   05231 Choline metabolism in cancer
    116814342
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    116814342
  09162 Cancer: specific types
   05210 Colorectal cancer
    116814342
   05225 Hepatocellular carcinoma
    116814342
   05226 Gastric cancer
    116814342
   05214 Glioma
    116814342
   05216 Thyroid cancer
    116814342
   05221 Acute myeloid leukemia
    116814342
   05220 Chronic myeloid leukemia
    116814342
   05218 Melanoma
    116814342
   05211 Renal cell carcinoma
    116814342
   05219 Bladder cancer
    116814342
   05215 Prostate cancer
    116814342
   05213 Endometrial cancer
    116814342
   05224 Breast cancer
    116814342
   05223 Non-small cell lung cancer
    116814342
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    116814342
   05170 Human immunodeficiency virus 1 infection
    116814342
   05161 Hepatitis B
    116814342
   05160 Hepatitis C
    116814342
   05164 Influenza A
    116814342
   05163 Human cytomegalovirus infection
    116814342
   05167 Kaposi sarcoma-associated herpesvirus infection
    116814342
   05165 Human papillomavirus infection
    116814342
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    116814342
   05135 Yersinia infection
    116814342
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    116814342
   05022 Pathways of neurodegeneration - multiple diseases
    116814342
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    116814342
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    116814342
   01522 Endocrine resistance
    116814342
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hmh01001]
    116814342
Enzymes [BR:hmh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     116814342
Protein kinases [BR:hmh01001]
 Serine/threonine kinases: STE group
  STE7 family
   116814342
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Pkinase_fungal
Other DBs
NCBI-GeneID: 116814342
NCBI-ProteinID: XP_032617582
LinkDB
Position
Unknown
AA seq 208 aa
MLARRKPVLRVLPALTINPTIAEGPSPASEGACEANLVDLQKKLEELELDKQQKRPEAFL
TQKAKIGELKDDDFERISELGAGNGGVVTNVQHRPSGLITARKLICLEIKPAIRNQIIRE
QQVLHKGNSPYIVGFYGAFCSDGEISIFVEHMDGGSLDQVLKEAKRIPEEIQGKVSIAVL
RGLAYLREKHQIMHRDVKPSNILVNSRG
NT seq 627 nt   +upstreamnt  +downstreamnt
atgttggcccggaggaagccggtgctgcgggtgctgccggcgctcaccatcaaccctacc
atcgccgagggcccgtccccagccagcgagggcgcctgcgaggcaaacctggtggacctg
cagaagaagctggaggagctggaacttgacaagcagcagaagcggccggaagcctttctc
acccagaaagccaagatcggcgaactcaaagacgatgacttcgaaaggatctcagagctg
ggcgcgggcaacggcggagtggtcaccaacgtccagcacagaccctcgggcctcatcacg
gccaggaagttgatctgccttgagatcaagccggccatccggaaccagatcatccgcgag
caacaggtcctgcacaagggcaactcgccatatatcgtgggcttctacggggccttctgc
agtgacggggagatcagcatcttcgtggagcacatggatggcggctccctggaccaggtg
ctgaaagaggccaagaggattcccgaggagatccaggggaaagtcagcattgcggttctc
cggggcttggcgtacctccgagagaagcaccagatcatgcaccgagatgtgaagccctcc
aacatcctcgtgaactctagagggtag

DBGET integrated database retrieval system