Vreelandella olivaria: HORIV_22540 Help Entry HORIV_22540       CDS       T06227                                  Name (GenBank) hypothetical protein   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism hol  Vreelandella olivaria Pathway hol00670   One carbon pool by folate hol00790   Folate biosynthesis hol01100   Metabolic pathways hol01240   Biosynthesis of cofactors hol04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:hol00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     HORIV_22540    00670 One carbon pool by folate     HORIV_22540  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     HORIV_22540 Enzymes [BR:hol01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      HORIV_22540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  BBI49833 LinkDB All DBs Position 1586721..1587146 Genome browser AA seq 141 aa AA seqDB search MSQQNDTSNQNGAFDSLVPVAMIVAMAKNRVIGVDGKLPWYLPEDLKFFKRMTQAKPLVM GRKTYASIGKPLPNRLNVVVTRNAEFSHEGVRVCHDLPAALELADQHATIEAAEEIMVMG AEKFTARHYPLPSGCTLRKWK NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atgagccaacaaaacgatacgagcaaccaaaacggcgctttcgattccctggtgccggtg gcaatgatcgttgccatggctaaaaatcgagtgatcggcgtagatggcaagttaccctgg tacctgcccgaagatttaaagttcttcaaacgcatgactcaggcaaaaccgctggtaatg gggcgtaaaacctacgcgtccattggcaagccgctgcccaaccggcttaatgtggtggtc acccgcaatgctgagttttcccacgaaggtgtacgcgtgtgtcatgacctccccgcagcg ctagagctagccgaccagcacgccactatagaagcggcagaagagatcatggtaatgggg gcggagaaatttaccgccaggcattaccctttgcccagcggctgtacattacggaagtgg aaataa

DBGET integrated database retrieval system