Helicobacter pylori B38: HELPY_1483 Help Entry HELPY_1483        CDS       T00950                                  Symbol folB Name (GenBank) Dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism hpb  Helicobacter pylori B38 Pathway hpb00790   Folate biosynthesis hpb01100   Metabolic pathways hpb01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:hpb00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     HELPY_1483 (folB) Enzymes [BR:hpb01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      HELPY_1483 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      HELPY_1483 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      HELPY_1483 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB PRONE Mad3_BUB1_II HTH_45 GT-D-like SBB_T7 Motif Other DBs NCBI-ProteinID:  CAX30186 UniProt:  C7C155 LinkDB All DBs Position 1466218..1466571 Genome browser AA seq 117 aa AA seqDB search MKTKQGVHIHNLVFETILGILEFERLKPQKISVNLDLFYTQLPNKTYLDYMEIQELIQKM MQEKQYLLIEDALKDLSHVLKTRYSGISELHLKISKLEISPNSQVGASVKICYESNL NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgaaaactaaacaaggcgttcatatccataacttggtgtttgagacgattttggggatt ttagaatttgaacgcttaaaaccccaaaaaataagcgtgaatttggatcttttctacacg caattacccaataagacttatttagactacatggaaatccaagagcttattcaaaagatg atgcaagaaaaacaataccttctcattgaagacgccctgaaagatttgagccatgtttta aaaacgcgctatagtggaatctctgagcttcatttaaaaatcagcaagttagaaatttct cccaattctcaagtgggagcgagcgtgaaaatttgctatgaaagcaatctttag

DBGET integrated database retrieval system