Helicobacter pylori G27: HPG27_1434 Help Entry HPG27_1434        CDS       T00777                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism hpg  Helicobacter pylori G27 Pathway hpg00790   Folate biosynthesis hpg01100   Metabolic pathways hpg01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:hpg00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     HPG27_1434 Enzymes [BR:hpg01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      HPG27_1434  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      HPG27_1434  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      HPG27_1434 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB GT-D-like PRONE Motif Other DBs NCBI-ProteinID:  ACI28177 UniProt:  B5Z9C8 Structure PDBPDBj LinkDB All DBs Position 1549455..1549808 Genome browser AA seq 117 aa AA seqDB search MKTKQGVHVHNLVFETILGILEFERLKPQKISVDLDLFYTQLPNKAYLDYIKIQELIQKM MQEKQYLLIEDALKDLSQILKTRYKEITELYLKISKLEISPDSQVGASVKICYENNL NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgaaaactaaacaaggcgttcatgtccataacttggtgtttgaaacgattttggggatt ttagagtttgaacgcttaaaaccccaaaaaataagcgtggatttggatcttttctacacg caattacccaataaggcttatttagactacataaaaatccaagagcttatccaaaagatg atgcaagaaaaacaatacttactcattgaagacgccctaaaagatctaagccaaatttta aaaacgcgctacaaggagatcactgaactttatttgaaaatcagcaagttagaaatttct cccgattctcaagtgggagcgagcgtgaaaatttgctatgaaaacaatctttag

DBGET integrated database retrieval system