Helicovermis profundi: HLPR_01110 Help Entry HLPR_01110        CDS       T09891                                  Symbol porD Name (GenBank) pyruvate synthase subunit PorD   KO K00188   2-oxoisovalerate ferredoxin oxidoreductase delta subunit [EC:1.2.7.7] Organism hprf  Helicovermis profundi Pathway hprf00280   Valine, leucine and isoleucine degradation hprf01100   Metabolic pathways hprf01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:hprf00001]  09100 Metabolism   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     HLPR_01110 (porD) Enzymes [BR:hprf01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.7  3-methyl-2-oxobutanoate dehydrogenase (ferredoxin)      HLPR_01110 (porD) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_7 Fer4_21 Fer4_2 Fer4_10 Fer4_9 Fer4_16 Fer4_4 Fer4_15 Fer4_17 Fer4_3 Fer4_8 Fer4_13 Motif Other DBs NCBI-ProteinID:  BEP27780 UniProt:  A0AAU9E1R5 LinkDB All DBs Position complement(138000..138299) Genome browser AA seq 99 aa AA seqDB search MNKPKLKKWKEPINISNYPLGATCESNHLVSINAGWRTYRPVINQDKCVKCLRCFLVCPD GVIDKSKELLEIDYDYCKGCGVCAYECKFDAIDMVKEEK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaataaacctaaactaaagaaatggaaagaaccaattaatatttcaaactatccacta ggagctacttgtgaaagtaatcatctagttagtattaacgcaggttggagaacttatagg cctgtaattaatcaagataaatgcgttaaatgcttaagatgtttcttagtttgcccagat ggagtaattgataaatctaaagaacttcttgaaattgactatgactattgcaaaggttgc ggagtttgcgcatacgaatgtaagtttgacgcaatagatatggtaaaggaggaaaaataa

DBGET integrated database retrieval system