Helicobacter pylori Cuz20: HPCU_07610 Help Entry HPCU_07610        CDS       T01894                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism hpu  Helicobacter pylori Cuz20 Pathway hpu00790   Folate biosynthesis hpu01100   Metabolic pathways hpu01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:hpu00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     HPCU_07610 Enzymes [BR:hpu01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      HPCU_07610  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      HPCU_07610  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      HPCU_07610 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DUF6063 Mad3_BUB1_II NEMO PRONE Endotoxin_N GT-D-like Motif Other DBs NCBI-ProteinID:  ADO04662 UniProt:  A0AB32XAH0 LinkDB All DBs Position 1529855..1530208 Genome browser AA seq 117 aa AA seqDB search MKTQQGVHIHNLVFETILGILEFERLKPQKISVNLDLFYTQLPNKAYLDYIKIQELIQKM MQENQYLLIEDALKDLSHALKTRYSEISELYLKISKLEISPNSQVGASVKICYENDL NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgaaaacccaacaaggcgttcatatccataacttggtgtttgaaacgattttggggatt ttagaatttgaacgcttaaaaccccaaaaaataagcgtgaatttggatcttttctacacg caattacccaataaggcttatttggactacataaaaatccaagagcttattcaaaaaatg atgcaagaaaaccaatacttactcattgaagacgccctgaaagatttgagccatgcttta aaaacgcgctatagtgaaatctctgagctttatttaaaaatcagcaagttagaaatttct ccaaattctcaagtgggagcgagcgtgaaaatttgctatgaaaacgatctttag

DBGET integrated database retrieval system