Henckelia pumila: 140887545 Help Entry 140887545         CDS       T11037                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism hpum  Henckelia pumila Pathway hpum03420   Nucleotide excision repair hpum04120   Ubiquitin mediated proteolysis hpum04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:hpum00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     140887545    04120 Ubiquitin mediated proteolysis     140887545   09124 Replication and repair    03420 Nucleotide excision repair     140887545  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:hpum04121]     140887545    03400 DNA repair and recombination proteins [BR:hpum03400]     140887545 Enzymes [BR:hpum01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      140887545 Ubiquitin system [BR:hpum04121]  Ubiquitin ligases (E3)   UBL E3 ligases    140887545   Multi subunit type E3    SCF complex     Ring finger protein      140887545    Cul2 complex      140887545    Cul3 complex      140887545    Cul4 complex      140887545    Cul7 complex      140887545    Cul8 complex      140887545    Cul9 complex      140887545 DNA repair and recombination proteins [BR:hpum03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       140887545     TCR (transcription coupled repair) factors      Cul4-CSA complex       140887545 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  140887545 NCBI-ProteinID:  XP_073150945 LinkDB All DBs Position 3:22388202..22390949 Genome browser AA seq 127 aa AA seqDB search MASLDTDVNMIPAGEGSSGAGPSNTTPTPVPSQSSKKAKRFEIKKWNAVALWAWDIVVDN CAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEW EFQKYGH NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atggcgtcgctggacaccgacgtgaacatgatccccgccggagagggatcttccggtgct ggaccctccaacactactcccacgccggtgccgtcgcaatcttccaagaaagccaagcga tttgagatcaagaagtggaacgccgtcgctctctgggcttgggatattgtggtcgataat tgtgctatttgcaggaaccatattatggatctctgcatcgagtgtcaggctaatcaagct agtgcgaccagtgaggagtgcactgttgcttggggtgtttgcaatcacgccttccatttc cactgcatcagcagatggctcaagactcgccaagtttgccccttggacaatagtgagtgg gagtttcagaagtatggtcactaa

DBGET integrated database retrieval system