Helicobacter pylori OK113: HPOK113_1424 Help Entry HPOK113_1424      CDS       T02510                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism hpyo  Helicobacter pylori OK113 Pathway hpyo00790   Folate biosynthesis hpyo01100   Metabolic pathways hpyo01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:hpyo00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     HPOK113_1424 (folB) Enzymes [BR:hpyo01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      HPOK113_1424 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      HPOK113_1424 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      HPOK113_1424 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DUF6063 Mad3_BUB1_II NEMO PRONE Endotoxin_N GT-D-like Motif Other DBs NCBI-ProteinID:  BAM97332 LinkDB All DBs Position 1507559..1507912 Genome browser AA seq 117 aa AA seqDB search MKTQQGVHIHNLVFETILGILEFERLKPQKISVNLDLFYTQLPNKAYLDYIKIQELIQKM MQENQYLLIEDALKDLSHALKTRYSEISELYLKISKLEISPNSQVGASVKICYENDL NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgaaaacccaacaaggcgttcatatccataaccttgtgtttgaaacgattttggggatt ttagaatttgaacgcttaaaaccccaaaaaataagcgtgaatttggatcttttctacacg caattacccaataaggcttatttagactacataaaaatccaagagcttattcaaaaaatg atgcaagaaaaccaatatcttctcattgaagacgccctgaaagatttgagtcatgcttta aaaacgcgctatagtgaaatctctgagctttatttaaaaatcagcaaattagaaatttct ccaaattctcaagtgggagcgagcgtgaaaatttgctatgaaaacgatctttag

DBGET integrated database retrieval system