Haliotis rufescens (red abalone): 124143675 Help Entry 124143675         CDS       T07893                                  Name (RefSeq) RING-box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism hrf  Haliotis rufescens (red abalone) Pathway hrf03420   Nucleotide excision repair hrf04120   Ubiquitin mediated proteolysis hrf04141   Protein processing in endoplasmic reticulum hrf04310   Wnt signaling pathway hrf04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:hrf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     124143675    04120 Ubiquitin mediated proteolysis     124143675   09124 Replication and repair    03420 Nucleotide excision repair     124143675  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     124143675    04350 TGF-beta signaling pathway     124143675  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:hrf04121]     124143675    03400 DNA repair and recombination proteins [BR:hrf03400]     124143675 Enzymes [BR:hrf01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      124143675 Ubiquitin system [BR:hrf04121]  Ubiquitin ligases (E3)   UBL E3 ligases    124143675   Multi subunit type E3    SCF complex     Ring finger protein      124143675    Cul2 complex      124143675    Cul3 complex      124143675    Cul4 complex      124143675    Cul7 complex      124143675    Cul8 complex      124143675    Cul9 complex      124143675 DNA repair and recombination proteins [BR:hrf03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       124143675     TCR (transcription coupled repair) factors      Cul4-CSA complex       124143675 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 PHD_NSD zf-RING_16 Motif Other DBs NCBI-GeneID:  124143675 NCBI-ProteinID:  XP_046368657 LinkDB All DBs Position Unknown AA seq 114 aa AA seqDB search MAAAMDIEEEMDNGAPAAPGDKGSKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCI ECQANQASATSEECTVAWGVCNHAFHFHCITRWLKTRQVCPLDNREWEFQKYGH NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atggccgcagcaatggatattgaagaagaaatggacaacggagcacccgcagctccagga gataaaggaagtaaaaaaagatttgaagtgaagaagtggaatgctgtggcactgtgggct tgggatattgtcgtagacaactgtgctatctgcagaaatcacatcatggatctgtgtatc gagtgccaggccaaccaagcctctgctactagtgaggagtgcactgtggcctggggagtc tgtaatcatgctttccacttccactgcatcactcggtggctgaagacgaggcaggtgtgc ccactggacaacagggagtgggagtttcagaagtatggtcattaa

DBGET integrated database retrieval system