Haliotis rubra (blacklip abalone): 124283910 Help Entry 124283910         CDS       T07967                                  Name (RefSeq) dihydrofolate reductase-like   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism hrj  Haliotis rubra (blacklip abalone) Pathway hrj00670   One carbon pool by folate hrj00790   Folate biosynthesis hrj01100   Metabolic pathways hrj01240   Biosynthesis of cofactors hrj04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:hrj00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     124283910    00670 One carbon pool by folate     124283910  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     124283910 Enzymes [BR:hrj01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      124283910 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-GeneID:  124283910 NCBI-ProteinID:  XP_046575900 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MSTIKGQTNFIISLPNLRHKRRYKMPGLNATNRKTAIAAIAHPLCKHIYLTRIYRDYDSD VFFPSFEDTFTESSDPDVDGKMREDNGIQFRFEVYDRK NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtcgactataaagggccaaaccaacttcatcatttcattaccaaatttacgacataaa cgaagatataaaatgccaggattgaatgctactaaccgaaagaccgccattgcagcgatt gcccatccgctgtgcaagcacatctatcttacaaggatctacagggactatgattccgat gtcttctttccctctttcgaagatacattcacggagagcagtgacccggatgtggatggg aagatgagagaggataacggaattcagttccggtttgaagtttatgaccggaagtga

DBGET integrated database retrieval system