Helobdella robusta: HELRODRAFT_136972 Help Entry HELRODRAFT_136972 CDS       T03272                                  Name (RefSeq) hypothetical protein   KO K02649   phosphoinositide-3-kinase regulatory subunit alpha/beta/delta Organism hro  Helobdella robusta Pathway hro04068   FoxO signaling pathway hro04070   Phosphatidylinositol signaling system hro04081   Hormone signaling hro04140   Autophagy - animal hro04150   mTOR signaling pathway hro04620   Toll-like receptor signaling pathway hro05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:hro00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     HELRODRAFT_136972    04070 Phosphatidylinositol signaling system     HELRODRAFT_136972    04150 mTOR signaling pathway     HELRODRAFT_136972   09133 Signaling molecules and interaction    04081 Hormone signaling     HELRODRAFT_136972  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     HELRODRAFT_136972  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     HELRODRAFT_136972  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     HELRODRAFT_136972  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hro04131]     HELRODRAFT_136972 Membrane trafficking [BR:hro04131]  Endocytosis   Rab GTPases and associated proteins    Rab associated proteins     HELRODRAFT_136972 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SH2 Motif Other DBs NCBI-GeneID:  20196368 NCBI-ProteinID:  XP_009013256 JGI:  Helro1_136972 UniProt:  T1EIG8 LinkDB All DBs Position Unknown AA seq 94 aa AA seqDB search REKANEILRDAKDGSFLVRDSTDKLGEANSDYTLTLKCNGSNKLIKIYHSDGLYGFAPPL KFTSVVHLIVYHQTHTLSCYNSTLSITLKYPVAK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt agagagaaggcaaacgaaattttgagagacgcaaaggatggatcatttttggtgagggat tctaccgacaaacttggtgaagctaattctgattacactctaacgttgaagtgcaatggt agtaacaagctcatcaaaatttatcattctgatggattgtatggatttgctccaccattg aaatttacttcagttgttcatctgattgtttatcatcaaactcacacattatcatgttat aacagcacactcagcattactttgaagtaccctgttgctaaa

DBGET integrated database retrieval system