Hirundo rustica (Barn swallow): 120752174 Help Entry 120752174         CDS       T09369                                  Symbol RBX1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism hrt  Hirundo rustica (Barn swallow) Pathway hrt03420   Nucleotide excision repair hrt04110   Cell cycle hrt04114   Oocyte meiosis hrt04120   Ubiquitin mediated proteolysis hrt04141   Protein processing in endoplasmic reticulum hrt04310   Wnt signaling pathway hrt04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:hrt00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     120752174 (RBX1)    04120 Ubiquitin mediated proteolysis     120752174 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     120752174 (RBX1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     120752174 (RBX1)    04350 TGF-beta signaling pathway     120752174 (RBX1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     120752174 (RBX1)    04114 Oocyte meiosis     120752174 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:hrt04121]     120752174 (RBX1)    03400 DNA repair and recombination proteins [BR:hrt03400]     120752174 (RBX1) Enzymes [BR:hrt01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      120752174 (RBX1) Ubiquitin system [BR:hrt04121]  Ubiquitin ligases (E3)   UBL E3 ligases    120752174 (RBX1)   Multi subunit type E3    SCF complex     Ring finger protein      120752174 (RBX1)    Cul2 complex      120752174 (RBX1)    Cul3 complex      120752174 (RBX1)    Cul4 complex      120752174 (RBX1)    Cul7 complex      120752174 (RBX1)    Cul8 complex      120752174 (RBX1)    Cul9 complex      120752174 (RBX1) DNA repair and recombination proteins [BR:hrt03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       120752174 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       120752174 (RBX1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  120752174 NCBI-ProteinID:  XP_039918795 LinkDB All DBs Position 4:complement(52047948..52058800) Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSGANSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggccgcaatggatgtggacacccccagcggagccaacagcggcgccggcaagaag cgcttcgaagtgaagaaatggaatgccgtagctctgtgggcatgggacattgtggttgat aactgtgccatttgcagaaaccacattatggatctatgcatagaatgtcaagccaaccaa gcatcagctacctctgaggagtgcacagttgcatggggcgtctgcaatcacgctttccac ttccactgcatctctcgctggctcaaaactcgccaagtatgtccactggacaacagggaa tgggagttccaaaagtatggacactag

DBGET integrated database retrieval system