KEGG   Homo sapiens (human): 1Help
Entry
1                 CDS       T01001                                 

Gene name
A1BG, A1B, ABG, GAB, HYST2477
Definition
(RefSeq) alpha-1-B glycoprotein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 ig
Motif
Other DBs
NCBI-GeneID: 1
NCBI-ProteinID: NP_570602
OMIM: 138670
HGNC: 5
Ensembl: ENSG00000121410
Vega: OTTHUMG00000183507
Pharos: P04217(Tbio)
UniProt: P04217 V9HWD8
LinkDB All DBs
Position
19q13.43
AA seq 495 aa AA seqDB search
MSMLVVFLLLWGVTWGPVTEAAIFYETQPSLWAESESLLKPLANVTLTCQAHLETPDFQL
FKNGVAQEPVHLDSPAIKHQFLLTGDTQGRYRCRSGLSTGWTQLSKLLELTGPKSLPAPW
LSMAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPGNY
SCSYRTDGEGALSEPSATVTIEELAAPPPPVLMHHGESSQVLHPGNKVTLTCVAPLSGVD
FQLRRGEKELLVPRSSTSPDRIFFHLNAVALGDGGHYTCRYRLHDNQNGWSGDSAPVELI
LSDETLPAPEFSPEPESGRALRLRCLAPLEGARFALVREDRGGRRVHRFQSPAGTEALFE
LHNISVADSANYSCVYVDLKPPFGGSAPSERLELHVDGPPPRPQLRATWSGAVLAGRDAV
LRCEGPIPDVTFELLREGETKAVKTVRTPGAAANLELIFVGPQHAGNYRCRYRSWVPHTF
ESELSDPVELLVAES
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgctcgtggtctttctcttgctgtggggtgtcacctggggcccagtgacagaa
gcagccatattttatgagacgcagcccagcctgtgggcagagtccgaatcactgctgaaa
cccttggccaatgtgacgctgacgtgccaggcccacctggagactccagacttccagctg
ttcaagaatggggtggcccaggagcctgtgcaccttgactcacctgccatcaagcaccag
ttcctgctgacgggtgacacccagggccgctaccgctgccgctcgggcttgtccacagga
tggacccagctgagcaagctcctggagctgacagggccaaagtccttgcctgctccctgg
ctctcgatggcgccagtgtcctggatcacccccggcctgaaaacaacagcagtgtgccga
ggtgtgctgcggggtgtgacttttctgctgaggcgggagggcgaccatgagtttctggag
gtgcctgaggcccaggaggatgtggaggccacctttccagtccatcagcctggcaactac
agctgcagctaccggaccgatggggaaggcgccctctctgagcccagcgctactgtgacc
attgaggagctcgctgcaccaccaccgcctgtgctgatgcaccatggagagtcctcccag
gtcctgcaccctggcaacaaggtgaccctcacctgcgtggctcccctgagtggagtggac
ttccagctacggcgcggggagaaagagctgctggtacccaggagcagcaccagcccagat
cgcatcttctttcacctgaacgcggtggccctgggggatggaggtcactacacctgccgc
taccggctgcatgacaaccaaaacggctggtccggggacagcgcgccggtcgagctgatt
ctgagcgatgagacgctgcccgcgccggagttctccccggagccggagtccggcagggcc
ttgcggctgcggtgcctggcgcccctggagggcgcgcgcttcgccctggtgcgcgaggac
aggggcgggcgccgcgtgcaccgtttccagagccccgctgggaccgaggcgctcttcgag
ctgcacaacatttccgtggctgactccgccaactacagctgcgtctacgtggacctgaag
ccgcctttcgggggctccgcgcccagcgagcgcttggagctgcacgtggacggaccccct
cccaggcctcagctccgggcgacgtggagtggggcggtcctggcgggccgagatgccgtc
ctgcgctgcgagggacccatccccgacgtcaccttcgagctgctgcgcgagggcgagacg
aaggccgtgaagacggtccgcacccccggggccgcggcgaacctcgagctgatcttcgtg
gggccccagcacgccggcaactacaggtgccgctaccgctcctgggtgccccacaccttc
gaatcggagctcagcgaccctgtggagctcctggtggcagaaagctga

DBGET integrated database retrieval system