KEGG   Homo sapiens (human): 100169851
Entry
100169851         CDS       T01001                                 
Symbol
PATE3, HEL-127, PATE-DJ
Name
(RefSeq) prostate and testis expressed 3
  KO
K25370  prostate and testis expressed protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100169851 (PATE3)
SSDB
Other DBs
NCBI-GeneID: 100169851
NCBI-ProteinID: NP_001123355
HGNC: 35426
Ensembl: ENSG00000236027
Vega: OTTHUMG00000165857
Pharos: B3GLJ2(Tdark)
UniProt: B3GLJ2
LinkDB
Position
11:125788127..125791600
AA seq 98 aa
MNKHFLFLFLLYCLIVAVTSLQCITCHLRTRTDRCRRGFGVCTAQKGEACMLLRIYQRNT
LQISYMVCQKFCRDMTFDLRNRTYVHTCCNYNYCNFKL
NT seq 297 nt   +upstreamnt  +downstreamnt
atgaacaaacacttcttgttcctcttcctcctttactgcctcattgtggcagtgacatca
cttcagtgcataacatgccaccttcgcacacggacagaccgctgtagaagaggctttggt
gtctgtactgctcagaagggcgaggcatgcatgctcttaaggatttaccagcgcaatact
ctccagatatcatacatggtgtgtcagaaattctgcagagacatgacatttgatctcagg
aatcggacttatgttcatacatgctgcaactacaattactgtaactttaaactctaa

KEGG   Homo sapiens (human): 130574
Entry
130574            CDS       T01001                                 
Symbol
LYPD6
Name
(RefSeq) LY6/PLAUR domain containing 6
  KO
K25367  Ly-6/uPAR domain-containing protein 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    130574 (LYPD6)
SSDB
Motif
Pfam: UPAR_LY6_2 Activin_recp
Other DBs
NCBI-GeneID: 130574
NCBI-ProteinID: NP_001182614
OMIM: 613359
HGNC: 28751
Ensembl: ENSG00000187123
Vega: OTTHUMG00000131852
Pharos: Q86Y78(Tdark)
UniProt: Q86Y78
Structure
LinkDB
Position
2:149329985..149486378
AA seq 171 aa
MEPGPALAWLLLLSLLADCLKAAQSRDFTVKDIIYLHPSTTPYPGGFKCFTCEKAADNYE
CNRWAPDIYCPRETRYCYTQHTMEVTGNSISVTKRCVPLEECLSTGCRDSEHEGHKVCTS
CCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMSVIVSCLWLWLGLML
NT seq 516 nt   +upstreamnt  +downstreamnt
atggaacctggccctgctctggcctggctcctgctcctgagcctgctggcggattgtctg
aaagctgctcagtcccgagacttcacagtgaaagacattatctacctccatccttcaacc
acaccatatcctggtggatttaaatgtttcacctgtgaaaaggcagcagacaattatgag
tgcaaccgatgggctccagacatctactgccctcgagagaccagatactgctacactcag
cacacaatggaagtcacaggaaacagtatctcagtcaccaaacgctgtgtcccactggaa
gagtgcttatccactggctgcagagactccgagcatgaaggccacaaggtctgcacttct
tgttgtgaaggaaatatctgtaacttgccactgccccgaaatgaaactgatgccacattt
gccacgacgtcacctataaatcagacaaatgggcacccacgctgtatgtcagtgatagtg
tcctgcttgtggttgtggttagggctcatgttatag

KEGG   Homo sapiens (human): 130576
Entry
130576            CDS       T01001                                 
Symbol
LYPD6B, CT116, LYPD7
Name
(RefSeq) LY6/PLAUR domain containing 6B
  KO
K25368  Ly-6/uPAR domain-containing protein 6B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    130576 (LYPD6B)
SSDB
Motif
Pfam: UPAR_LY6_2
Other DBs
NCBI-GeneID: 130576
NCBI-ProteinID: NP_001303932
HGNC: 27018
Ensembl: ENSG00000150556
Vega: OTTHUMG00000153743
Pharos: Q8NI32(Tdark)
UniProt: Q8NI32
Structure
LinkDB
Position
2:149038699..149215262
AA seq 183 aa
MLYKSSDRPAHKVSMLLLCHALAIAVVQIVIFSESWAFAKNINFYNVRPPLDPTPFPNSF
KCFTCENAGDNYNCNRWAEDKWCPQNTQYCLTVHHFTSHGRSTSITKKCASRSECHFVGC
HHSRDSEHTECRSCCEGMICNVELPTNHTNAVFAVMHAQRTSGSSAPTLYLPVLAWVFVL
PLL
NT seq 552 nt   +upstreamnt  +downstreamnt
atgttatataagagttcggaccgcccagcacacaaggtcagcatgctgctcctctgtcac
gctctcgctatagctgttgtccagatcgttatcttctcagaaagctgggcatttgccaag
aacatcaacttctataatgtgaggcctcctctcgaccctacaccatttccaaatagcttc
aagtgctttacttgtgaaaacgcaggggataattataactgcaatcgatgggcagaagac
aaatggtgtccacaaaatacacagtactgtttgacagttcatcacttcaccagccacgga
agaagcacatccatcaccaaaaagtgtgcctccagaagtgaatgtcattttgtcggttgc
caccacagccgagattctgaacatacggagtgtaggtcttgctgtgaaggaatgatctgc
aatgtagaattacccaccaatcacactaatgcagtgtttgccgtaatgcacgctcagaga
acatctggcagcagtgcccccacactctacctaccagtgcttgcctgggtctttgtgctt
ccattgctgtga

KEGG   Homo sapiens (human): 160065
Entry
160065            CDS       T01001                                 
Symbol
PATE1, PATE
Name
(RefSeq) prostate and testis expressed 1
  KO
K25370  prostate and testis expressed protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    160065 (PATE1)
SSDB
Motif
Pfam: DUF4723
Other DBs
NCBI-GeneID: 160065
NCBI-ProteinID: NP_612151
OMIM: 606861
HGNC: 24664
Ensembl: ENSG00000171053
Vega: OTTHUMG00000165855
Pharos: Q8WXA2(Tdark)
UniProt: Q8WXA2
LinkDB
Position
11:125746279..125749867
AA seq 126 aa
MDKSLLLELPILLCCFRALSGSLSMRNDAVNEIVAVKNNFPVIEIVQCRMCHLQFPGEKC
SRGRGICTATTEEACMVGRMFKRDGNPWLTFMGCLKNCADVKGIRWSVYLVNFRCCRSHD
LCNEDL
NT seq 381 nt   +upstreamnt  +downstreamnt
atggacaagtccctcttgctggaactccccatcctgctctgctgctttagggcattatct
ggatcactttcaatgagaaatgatgcagtcaatgaaatagttgctgtgaaaaacaatttt
cctgtgatagaaattgttcagtgtaggatgtgccacctccagttcccaggagaaaagtgc
tccagaggaagaggaatatgcacagcaacaacagaagaggcctgcatggttggaaggatg
ttcaaaagggatggtaatccctggttaaccttcatgggctgcctaaagaactgtgctgat
gtgaaaggcataaggtggagtgtctatttggtgaacttcaggtgctgcaggagccatgac
ctgtgcaatgaagacctttag

KEGG   Homo sapiens (human): 399967
Entry
399967            CDS       T01001                                 
Symbol
PATE2, C11orf38, PATE-M, UNQ3112
Name
(RefSeq) prostate and testis expressed 2
  KO
K25370  prostate and testis expressed protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    399967 (PATE2)
SSDB
Other DBs
NCBI-GeneID: 399967
NCBI-ProteinID: NP_997720
HGNC: 32249
Ensembl: ENSG00000196844
Vega: OTTHUMG00000165856
Pharos: Q6UY27(Tdark)
UniProt: Q6UY27
LinkDB
Position
11:complement(125776113..125778828)
AA seq 113 aa
MLVLFLLGTVFLLCPYWGELHDPIKATEIMCYECKKYHLGLCYGVMTSCSLKHKQSCAVE
NFYILTRKGQSMYHYSKLSCMTSCEDINFLGFTKRVELICCDHSNYCNLPEGV
NT seq 342 nt   +upstreamnt  +downstreamnt
atgcttgttctctttctcctgggcacagtctttctgctctgcccatattggggtgaactt
catgaccctataaaagcgactgaaataatgtgttatgaatgtaaaaaatatcatcttggg
ttatgctatggtgtcatgacatcctgctccctgaagcataaacagtcctgtgcagttgag
aacttttacatccttacaaggaaagggcagagcatgtatcattattcaaaactgtcgtgt
atgaccagctgtgaggacatcaacttcctggggttcacgaagagggtagagctcatctgt
tgtgatcatagtaactactgcaacctccctgagggagtttag

KEGG   Homo sapiens (human): 399968
Entry
399968            CDS       T01001                                 
Symbol
PATE4, PATE-B
Name
(RefSeq) prostate and testis expressed 4
  KO
K25370  prostate and testis expressed protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    399968 (PATE4)
SSDB
Motif
Pfam: DUF4723 Activin_recp
Other DBs
NCBI-GeneID: 399968
NCBI-ProteinID: NP_001138346
HGNC: 35427
Ensembl: ENSG00000237353
Vega: OTTHUMG00000165235
Pharos: P0C8F1(Tdark)
UniProt: P0C8F1
LinkDB
Position
11:125833316..125840072
AA seq 98 aa
MRKMNTLLLVSLSFLYLKEVMGLKCNTCIYTEGWKCMAGRGTCIAKENELCSTTAYFRGD
KHMYSTHMCKYKCREEESSKRGLLRVTLCCDRNFCNVF
NT seq 297 nt   +upstreamnt  +downstreamnt
atgaggaaaatgaacacactgctccttgtgagcttatcttttctctacctcaaagaggtt
atgggtctgaagtgtaatacctgcatatacacagaaggatggaagtgtatggcaggccga
ggcacttgcattgcaaaagaaaatgagttatgttcaacaacagcctatttcaggggagac
aaacatatgtactcaacacatatgtgtaagtataagtgccgggaagaggagtcctccaaa
agaggcctgttgagagtgacactgtgctgtgacagaaacttctgtaatgtcttctaa

KEGG   Homo sapiens (human): 432355
Entry
432355            CDS       T01001                                 
Symbol
SLURP2, SLURP-2
Name
(RefSeq) secreted LY6/PLAUR domain containing 2
  KO
K23682  secreted Ly-6/uPAR-related protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    432355 (SLURP2)
SSDB
Motif
Pfam: UPAR_LY6 Toxin_TOLIP DUF3439 Ribosomal_L3
Other DBs
NCBI-GeneID: 432355
NCBI-ProteinID: NP_803253
HGNC: 25549
Ensembl: ENSG00000283992
UniProt: P0DP57
Structure
LinkDB
Position
8:complement(142764338..142769828)
AA seq 97 aa
MQLGTGLLLAAVLSLQLAAAEAIWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTED
LPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD
NT seq 294 nt   +upstreamnt  +downstreamnt
atgcagctcggcactgggctcctgctggccgccgtcctgagcctgcagctggctgcagcc
gaagccatatggtgtcaccagtgcacgggcttcggagggtgctcccatggatccagatgc
ctgagggactccacccactgtgtcaccactgccacccgggtcctcagcaacaccgaggat
ttgcctctggtcaccaagatgtgccacataggctgccccgatatccccagcctgggcctg
ggcccctacgtatccatcgcttgctgccagaccagcctctgcaaccatgactga

KEGG   Homo sapiens (human): 57152
Entry
57152             CDS       T01001                                 
Symbol
SLURP1, ANUP, ARS, ArsB, LY6-MT, LY6LS, MDM
Name
(RefSeq) secreted LY6/PLAUR domain containing 1
  KO
K23681  secreted Ly-6/uPAR-related protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H00695  Mal de Meleda
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    57152 (SLURP1)
SSDB
Motif
Pfam: UPAR_LY6 Toxin_TOLIP
Other DBs
NCBI-GeneID: 57152
NCBI-ProteinID: NP_065160
OMIM: 606119
HGNC: 18746
Ensembl: ENSG00000126233
Vega: OTTHUMG00000164685
Pharos: P55000(Tbio)
UniProt: P55000
Structure
LinkDB
Position
8:complement(142740949..142742406)
AA seq 103 aa
MASRWAVQLLLVAAWSMGCGEALKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAE
YPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
NT seq 312 nt   +upstreamnt  +downstreamnt
atggcctctcgctgggctgtgcagctgctgctcgtggcagcctggagcatgggctgtggt
gaggccctcaagtgctacacctgcaaggagcccatgaccagtgcttcctgcaggaccatt
acccgctgcaagccagaggacacagcctgcatgaccacgctggtgacggtggaggcagag
taccccttcaaccagagccccgtggtgacccgctcctgctccagctcctgtgtggccacc
gaccccgacagcatcggggccgcccacctgatcttctgctgcttccgagacctctgcaac
tcggaactctga

KEGG   Homo sapiens (human): 66004
Entry
66004             CDS       T01001                                 
Symbol
LYNX1
Name
(RefSeq) Ly6/neurotoxin 1
  KO
K25369  Ly-6/neurotoxin-like protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    66004 (LYNX1)
SSDB
Motif
Pfam: Toxin_TOLIP UPAR_LY6
Other DBs
NCBI-GeneID: 66004
NCBI-ProteinID: NP_803252
OMIM: 606110
HGNC: 29604
Ensembl: ENSG00000180155
Vega: OTTHUMG00000164694
Pharos: Q9BZG9(Tbio)
UniProt: P0DP58
Structure
LinkDB
Position
8:complement(142771197..142777872)
AA seq 116 aa
MTPLLTLILVVLMGLPLAQALDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTYYTPTRMKV
SKSCVPRCFETVYDGYSKHASTTSCCQYDLCNGTGLATPATLALAPILLATLWGLL
NT seq 351 nt   +upstreamnt  +downstreamnt
atgacgcccctgctcaccctgatcctggtggtcctcatgggcttacctctggcccaggcc
ttggactgccacgtgtgtgcctacaacggagacaactgcttcaaccccatgcgctgcccg
gctatggttgcctactgcatgaccacgcgcacctactacacccccaccaggatgaaggtc
agtaagtcctgcgtgccccgctgcttcgagactgtgtatgatggctactccaagcacgcg
tccaccacctcctgctgccagtacgacctctgcaacggcaccggccttgccaccccggcc
accctggccctggcccccatcctcctggccaccctctggggtctcctctaa

DBGET integrated database retrieval system