KEGG   Homo sapiens (human): 100506013
Entry
100506013         CDS       T01001                                 

Symbol
APELA, ELA, Ende, tdl
Name
(RefSeq) apelin receptor early endogenous ligand
  KO
K25355  apelin receptor early endogenous ligand
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100506013 (APELA)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100506013 (APELA)
SSDB
Other DBs
NCBI-GeneID: 100506013
NCBI-ProteinID: NP_001284479
OMIM: 615594
HGNC: 48925
Ensembl: ENSG00000248329
Vega: OTTHUMG00000161255
Pharos: P0DMC3(Tdark)
UniProt: P0DMC3 X5D2P3
LinkDB
Position
4q32.3
AA seq 54 aa
MRFQQFLFAFFIFIMSLLLISGQRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP
NT seq 165 nt   +upstreamnt  +downstreamnt
atgagatttcagcaattcctttttgcattttttatttttattatgagtcttctccttatc
agcggacagagaccagttaatttgaccatgagaagaaaactgcgcaaacacaattgcctt
cagaggagatgtatgcctctccattcacgagtaccctttccctga

DBGET integrated database retrieval system