KEGG   Homo sapiens (human): 10057
Entry
10057             CDS       T01001                                 
Symbol
ABCC5, ABC33, EST277145, MOAT-C, MOATC, MRP5, SMRP, pABC11
Name
(RefSeq) ATP binding cassette subfamily C member 5
  KO
K05668  ATP-binding cassette, subfamily C (CFTR/MRP), member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa01523  Antifolate resistance
hsa02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    10057 (ABCC5)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    10057 (ABCC5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    10057 (ABCC5)
Transporters [BR:hsa02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    10057 (ABCC5)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_29 AAA_23 Dynamin_N TsaE RsgA_GTPase cobW AAA_13
Other DBs
NCBI-GeneID: 10057
NCBI-ProteinID: NP_005679
OMIM: 605251
HGNC: 56
Ensembl: ENSG00000114770
UniProt: O15440
LinkDB
Position
3:complement(183919934..184017884)
AA seq 1437 aa
MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLS
LDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLAR
VAHKKGELSMEDVWSLSKHESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLI
LSIVCLMITQLAGFSGPAFMVKHLLEYTQATESNLQYSLLLVLGLLLTEIVRSWSLALTW
ALNYRTGVRLRGAILTMAFKKILKLKNIKEKSLGELINICSNDGQRMFEAAAVGSLLAGG
PVVAILGMIYNVIILGPTGFLGSAVFILFYPAMMFASRLTAYFRRKCVAATDERVQKMNE
VLTYIKFIKMYAWVKAFSQSVQKIREEERRILEKAGYFQSITVGVAPIVVVIASVVTFSV
HMTLGFDLTAAQAFTVVTVFNSMTFALKVTPFSVKSLSEASVAVDRFKSLFLMEEVHMIK
NKPASPHIKIEMKNATLAWDSSHSSIQNSPKLTPKMKKDKRASRGKKEKVRQLQRTEHQA
VLAEQKGHLLLDSDERPSPEEEEGKHIHLGHLRLQRTLHSIDLEIQEGKLVGICGSVGSG
KTSLISAILGQMTLLEGSIAISGTFAYVAQQAWILNATLRDNILFGKEYDEERYNSVLNS
CCLRPDLAILPSSDLTEIGERGANLSGGQRQRISLARALYSDRSIYILDDPLSALDAHVG
NHIFNSAIRKHLKSKTVLFVTHQLQYLVDCDEVIFMKEGCITERGTHEELMNLNGDYATI
FNNLLLGETPPVEINSKKETSGSQKKSQDKGPKTGSVKKEKAVKPEEGQLVQLEEKGQGS
VPWSVYGVYIQAAGGPLAFLVIMALFMLNVGSTAFSTWWLSYWIKQGSGNTTVTRGNETS
VSDSMKDNPHMQYYASIYALSMAVMLILKAIRGVVFVKGTLRASSRLHDELFRRILRSPM
KFFDTTPTGRILNRFSKDMDEVDVRLPFQAEMFIQNVILVFFCVGMIAGVFPWFLVAVGP
LVILFSVLHIVSRVLIRELKRLDNITQSPFLSHITSSIQGLATIHAYNKGQEFLHRYQEL
LDDNQAPFFLFTCAMRWLAVRLDLISIALITTTGLMIVLMHGQIPPAYAGLAISYAVQLT
GLFQFTVRLASETEARFTSVERINHYIKTLSLEAPARIKNKAPSPDWPQEGEVTFENAEM
RYRENLPLVLKKVSFTIKPKEKIGIVGRTGSGKSSLGMALFRLVELSGGCIKIDGVRISD
IGLADLRSKLSIIPQEPVLFSGTVRSNLDPFNQYTEDQIWDALERTHMKECIAQLPLKLE
SEVMENGDNFSVGERQLLCIARALLRHCKILILDEATAAMDTETDLLIQETIREAFADCT
MLTIAHRLHTVLGSDRIMVLAQGQVVEFDTPSVLLSNDSSRFYAMFAAAENKVAVKG
NT seq 4314 nt   +upstreamnt  +downstreamnt
atgaaggatatcgacataggaaaagagtatatcatccccagtcctgggtatagaagtgtg
agggagagaaccagcacttctgggacgcacagagaccgtgaagattccaagttcaggaga
actcgaccgttggaatgccaagatgccttggaaacagcagcccgagccgagggcctctct
cttgatgcctccatgcattctcagctcagaatcctggatgaggagcatcccaagggaaag
taccatcatggcttgagtgctctgaagcccatccggactacttccaaacaccagcaccca
gtggacaatgctgggcttttttcctgtatgactttttcgtggctttcttctctggcccgt
gtggcccacaagaagggggagctctcaatggaagacgtgtggtctctgtccaagcacgag
tcttctgacgtgaactgcagaagactagagagactgtggcaagaagagctgaatgaagtt
gggccagacgctgcttccctgcgaagggttgtgtggatcttctgccgcaccaggctcatc
ctgtccatcgtgtgcctgatgatcacgcagctggctggcttcagtggaccagccttcatg
gtgaaacacctcttggagtatacccaggcaacagagtctaacctgcagtacagcttgttg
ttagtgctgggcctcctcctgacggaaatcgtgcggtcttggtcgcttgcactgacttgg
gcattgaattaccgaaccggtgtccgcttgcggggggccatcctaaccatggcatttaag
aagatccttaagttaaagaacattaaagagaaatccctgggtgagctcatcaacatttgc
tccaacgatgggcagagaatgtttgaggcagcagccgttggcagcctgctggctggagga
cccgttgttgccatcttaggcatgatttataatgtaattattctgggaccaacaggcttc
ctgggatcagctgtttttatcctcttttacccagcaatgatgtttgcatcacggctcaca
gcatatttcaggagaaaatgcgtggccgccacggatgaacgtgtccagaagatgaatgaa
gttcttacttacattaaatttatcaaaatgtatgcctgggtcaaagcattttctcagagt
gttcaaaaaatccgcgaggaggagcgtcggatattggaaaaagctgggtacttccagagc
atcactgtgggtgtggctcccattgtggtggtgattgccagcgtggtgaccttctctgtt
catatgaccctgggcttcgatctgacagcagcacaggctttcacagtggtgacagtcttc
aattccatgacttttgctttgaaagtaacaccgttttcagtaaagtccctctcagaagcc
tcagtggctgttgacagatttaagagtttgtttctaatggaagaggttcacatgataaag
aacaaaccagccagtcctcacatcaagatagagatgaaaaatgccaccttggcatgggac
tcctcccactccagtatccagaactcgcccaagctgacccccaaaatgaaaaaagacaag
agggcttccaggggcaagaaagagaaggtgaggcagctgcagcgcactgagcatcaggcg
gtgctggcagagcagaaaggccacctcctcctggacagtgacgagcggcccagtcccgaa
gaggaagaaggcaagcacatccacctgggccacctgcgcttacagaggacactgcacagc
atcgatctggagatccaagagggtaaactggttggaatctgtggcagtgtgggaagtgga
aaaacctctctcatttcagccattttaggccagatgacgcttctagagggcagcattgca
atcagtggaaccttcgcttatgtggcccagcaggcctggatcctcaatgctactctgaga
gacaacatcctgtttgggaaggaatatgatgaagaaagatacaactctgtgctgaacagc
tgctgcctgaggcctgacctggccattcttcccagcagcgacctgacggagattggagag
cgaggagccaacctgagcggtgggcagcgccagaggatcagccttgcccgggccttgtat
agtgacaggagcatctacatcctggacgaccccctcagtgccttagatgcccatgtgggc
aaccacatcttcaatagtgctatccggaaacatctcaagtccaagacagttctgtttgtt
acccaccagttacagtacctggttgactgtgatgaagtgatcttcatgaaagagggctgt
attacggaaagaggcacccatgaggaactgatgaatttaaatggtgactatgctaccatt
tttaataacctgttgctgggagagacaccgccagttgagatcaattcaaaaaaggaaacc
agtggttcacagaagaagtcacaagacaagggtcctaaaacaggatcagtaaagaaggaa
aaagcagtaaagccagaggaagggcagcttgtgcagctggaagagaaagggcagggttca
gtgccctggtcagtatatggtgtctacatccaggctgctgggggccccttggcattcctg
gttattatggcccttttcatgctgaatgtaggcagcaccgccttcagcacctggtggttg
agttactggatcaagcaaggaagcgggaacaccactgtgactcgagggaacgagacctcg
gtgagtgacagcatgaaggacaatcctcatatgcagtactatgccagcatctacgccctc
tccatggcagtcatgctgatcctgaaagccattcgaggagttgtctttgtcaagggcacg
ctgcgagcttcctcccggctgcatgacgagcttttccgaaggatccttcgaagccctatg
aagttttttgacacgacccccacagggaggattctcaacaggttttccaaagacatggat
gaagttgacgtgcggctgccgttccaggccgagatgttcatccagaacgttatcctggtg
ttcttctgtgtgggaatgatcgcaggagtcttcccgtggttccttgtggcagtggggccc
cttgtcatcctcttttcagtcctgcacattgtctccagggtcctgattcgggagctgaag
cgtctggacaatatcacgcagtcacctttcctctcccacatcacgtccagcatacagggc
cttgccaccatccacgcctacaataaagggcaggagtttctgcacagataccaggagctg
ctggatgacaaccaagctcctttttttttgtttacgtgtgcgatgcggtggctggctgtg
cggctggacctcatcagcatcgccctcatcaccaccacggggctgatgatcgttcttatg
cacgggcagattcccccagcctatgcgggtctcgccatctcttatgctgtccagttaacg
gggctgttccagtttacggtcagactggcatctgagacagaagctcgattcacctcggtg
gagaggatcaatcactacattaagactctgtccttggaagcacctgccagaattaagaac
aaggctccctcccctgactggccccaggagggagaggtgacctttgagaacgcagagatg
aggtaccgagaaaacctccctctcgtcctaaagaaagtatccttcacgatcaaacctaaa
gagaagattggcattgtggggcggacaggatcagggaagtcctcgctggggatggccctc
ttccgtctggtggagttatctggaggctgcatcaagattgatggagtgagaatcagtgat
attggccttgccgacctccgaagcaaactctctatcattcctcaagagccggtgctgttc
agtggcactgtcagatcaaatttggaccccttcaaccagtacactgaagaccagatttgg
gatgccctggagaggacacacatgaaagaatgtattgctcagctacctctgaaacttgaa
tctgaagtgatggagaatggggataacttctcagtgggggaacggcagctcttgtgcata
gctagagccctgctccgccactgtaagattctgattttagatgaagccacagctgccatg
gacacagagacagacttattgattcaagagaccatccgagaagcatttgcagactgtacc
atgctgaccattgcccatcgcctgcacacggttctaggctccgataggattatggtgctg
gcccagggacaggtggtggagtttgacaccccatcggtccttctgtccaacgacagttcc
cgattctatgccatgtttgctgctgcagagaacaaggtcgctgtcaagggctga

DBGET integrated database retrieval system