KEGG   Homo sapiens (human): 1013
Entry
1013              CDS       T01001                                 
Symbol
CDH15, CDH14, CDH3, CDHM, MCAD, MRD3
Name
(RefSeq) cadherin 15
  KO
K06809  cadherin 15, M-cadherin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
Disease
H00773  Autosomal dominant intellectual developmental disorder
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    1013 (CDH15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    1013 (CDH15)
Cell adhesion molecules [BR:hsa04515]
 Cadherins
  Major cadherins
   1013 (CDH15)
SSDB
Motif
Pfam: Cadherin CADH_Y-type_LIR Big_9
Other DBs
NCBI-GeneID: 1013
NCBI-ProteinID: NP_004924
OMIM: 114019
HGNC: 1754
Ensembl: ENSG00000129910
Pharos: P55291(Tbio)
UniProt: P55291
LinkDB
Position
16:89171748..89195492
AA seq 814 aa
MDAAFLLVLGLLAQSLCLSLGVPGWRRPTTLYPWRRAPALSRVRRAWVIPPISVSENHKR
LPYPLVQIKSDKQQLGSVIYSIQGPGVDEEPRGVFSIDKFTGKVFLNAMLDREKTDRFRL
RAFALDLGGSTLEDPTDLEIVVVDQNDNRPAFLQEAFTGRVLEGAVPGTYVTRAEATDAD
DPETDNAALRFSILQQGSPELFSIDELTGEIRTVQVGLDREVVAVYNLTLQVADMSGDGL
TATASAIITLDDINDNAPEFTRDEFFMEAIEAVSGVDVGRLEVEDRDLPGSPNWVARFTI
LEGDPDGQFTIRTDPKTNEGVLSIVKALDYESCEHYELKVSVQNEAPLQAAALRAERGQA
KVRVHVQDTNEPPVFQENPLRTSLAEGAPPGTLVATFSARDPDTEQLQRLSYSKDYDPED
WLQVDAATGRIQTQHVLSPASPFLKGGWYRAIVLAQDDASQPRTATGTLSIEILEVNDHA
PVLAPPPPGSLCSEPHQGPGLLLGATDEDLPPHGAPFHFQLSPRLPELGRNWSLSQVNVS
HARLRPRHQVPEGLHRLSLLLRDSGQPPQQREQPLNVTVCRCGKDGVCLPGAAALLAGGT
GLSLGALVIVLASALLLLVLVLLVALRARFWKQSRGKGLLHGPQDDLRDNVLNYDEQGGG
EEDQDAYDISQLRHPTALSLPLGPPPLRRDAPQGRLHPQPPRVLPTSPLDIADFINDGLE
AADSDPSVPPYDTALIYDYEGDGSVAGTLSSILSSQGDEDQDYDYLRDWGPRFARLADMY
GHPCGLEYGARWDHQAREGLSPGALLPRHRGRTA
NT seq 2445 nt   +upstreamnt  +downstreamnt
atggacgccgcgttcctcctcgtcctcgggctgttggcccagagcctctgcctgtctttg
ggggttcctggatggaggaggcccaccaccctgtacccctggcgccgggcgcctgccctg
agccgcgtgcggagggcctgggtcatccccccgatcagcgtatccgagaaccacaagcgt
ctcccctaccccctggttcagatcaagtcggacaagcagcagctgggcagcgtcatctac
agcatccagggacccggcgtggatgaggagccccggggcgtcttctctatcgacaagttc
acagggaaggtcttcctcaatgccatgctggaccgcgagaagactgatcgcttcaggcta
agagcgtttgccctggacctgggaggatccaccctggaggaccccacggacctggagatt
gtagttgtggatcagaatgacaaccggccagccttcctgcaggaggcgttcactggccgc
gtgctggagggtgcagtcccaggcacctatgtgaccagggcagaggccacagatgccgac
gaccccgagacggacaacgcagcgctgcggttctccatcctgcagcagggcagccccgag
ctcttcagcatcgacgagctcacaggagagatccgcacagtgcaagtggggctggaccgc
gaggtggtcgcggtgtacaatctgaccctgcaggtggcggacatgtctggagacggcctc
acagccactgcctcagccatcatcacccttgatgacatcaatgacaatgcccccgagttc
accagggatgagttcttcatggaggccatagaggccgtcagcggagtggatgtgggacgc
ctggaagtggaggacagggacctgccaggctccccaaactgggtggccaggttcaccatc
ctggaaggcgaccccgatgggcagttcaccatccgcacggaccccaagaccaacgagggt
gttctgtccattgtgaaggccctggactatgagagctgtgaacactacgaactcaaagtg
tcggtgcagaatgaggccccgctgcaggcggctgcccttagggctgagcggggccaggcc
aaggtccgcgtgcatgtgcaggacaccaacgagccccccgtgttccaggagaacccactt
cggaccagcctagcagagggggcacccccaggcactctggtggccaccttctctgcccgg
gaccctgacacagagcagctgcagaggctcagctactccaaggactacgacccggaagac
tggctgcaagtggacgcagccactggccggatccagacccagcacgtgctcagcccggcg
tcccccttcctcaagggcggctggtacagagccatcgtcctggcccaggatgacgcctcc
cagccccgcaccgccaccggcaccctgtccatcgagatcctggaggtgaacgaccatgca
cctgtgctggccccgccgccgccgggcagcctgtgcagcgagccacaccaaggcccaggc
ctcctcctgggcgccacggatgaggacctgcccccccacggggcccccttccacttccag
ctgagccccaggctcccagagctcggccggaactggagcctcagccaggtcaacgtgagc
cacgcgcgcctgcggccgcgacaccaggtccccgaaggcctgcaccgcctcagcctgctg
ctccgggactcggggcagccgccccagcagcgcgagcagcctctgaacgtgaccgtgtgc
cgctgcggcaaggacggcgtctgcctgccgggggccgcagcgctgctggcggggggcaca
ggcctcagcctgggcgcactggtcatcgtgctggccagcgccctcctgctgctggtgctg
gtcctgctcgtggcactccgggcgcggttctggaagcagtctcggggcaaggggctgctg
cacggcccccaggacgaccttcgagacaatgtcctcaactacgatgagcaaggaggcggg
gaggaggaccaggacgcctacgacatcagccagctgcgtcacccgacagcgctgagcctg
cctctgggaccgccgccacttcgcagagatgccccgcagggccgcctgcacccccagcca
ccccgagtgctgcccaccagccccctggacatcgccgacttcatcaatgatggcttggag
gctgcagatagtgaccccagtgtgccgccttacgacacagccctcatctatgactacgag
ggtgacggctcggtggcggggacgctgagctccatcctgtccagccagggcgatgaggac
caggactacgactacctcagagactgggggccccgcttcgcccggctggcagacatgtat
gggcacccgtgcgggttggagtacggggccagatgggaccaccaggccagggagggtctt
tctcctggggcactgctacccagacacagaggccggacagcctga

DBGET integrated database retrieval system