KEGG   Homo sapiens (human): 10134
Entry
10134             CDS       T01001                                 
Symbol
BCAP31, 6C6-AG, BAP31, CDM, DDCH, DXS1357E
Name
(RefSeq) B cell receptor associated protein 31
  KO
K14009  B-cell receptor-associated protein 31
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa05165  Human papillomavirus infection
Network
nt06129  MHC presentation (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00364  HPV E5 to antigen processing and presentation by MHC class I molecules
Disease
H02287  Deafness, dystonia, and cerebral hypomyelination
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10134 (BCAP31)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    10134 (BCAP31)
SSDB
Motif
Pfam: Bap31 Bap31_Bap29_C ATG14 ATG16 Sec34 BRE1 DUF4201 DUF996 LMF1 DUF730 DUF3498 NicO HMMR_C UPF0370 DUF3627 TPR_MLP1_2 Rx_N DUF4407 Fib_alpha Macoilin WXG100 HrpB7 ERM_C APG6_N Lebercilin bZIP_1
Other DBs
NCBI-GeneID: 10134
NCBI-ProteinID: NP_001132913
OMIM: 300398
HGNC: 16695
Ensembl: ENSG00000185825
Vega: OTTHUMG00000024218
Pharos: P51572(Tbio)
UniProt: P51572
Structure
LinkDB
Position
X:complement(153700492..153724387)
AA seq 246 aa
MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILV
LLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLV
TLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEE
NRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGP
MDKKEE
NT seq 741 nt   +upstreamnt  +downstreamnt
atgagtctgcagtggactgcagttgccaccttcctctatgcggaggtctttgttgtgttg
cttctctgcattcccttcatttctcctaaaagatggcagaagattttcaagtcccggctg
gtggagttgttagtgtcctatggcaacaccttctttgtggttctcattgtcatccttgtg
ctgttggtcatcgatgccgtgcgcgaaattcggaagtatgatgatgtgacggaaaaggtg
aacctccagaacaatcccggggccatggagcacttccacatgaagcttttccgtgcccag
aggaatctctacattgctggcttttccttgctgctgtccttcctgcttagacgcctggtg
actctcatttcgcagcaggccacgctgctggcctccaatgaagcctttaaaaagcaggcg
gagagtgctagtgaggcggccaagaagtacatggaggagaatgaccagctcaagaaggga
gctgctgttgacggaggcaagttggatgtcgggaatgctgaggtgaagttggaggaagag
aacaggagcctgaaggctgacctgcagaagctaaaggacgagctggccagcactaagcaa
aaactagagaaagctgaaaaccaggttctggccatgcggaagcagtctgagggcctcacc
aaggagtacgaccgcttgctggaggagcacgcaaagctgcaggctgcagtagatggtccc
atggacaagaaggaagagtaa

DBGET integrated database retrieval system