KEGG   Homo sapiens (human): 1015
Entry
1015              CDS       T01001                                 
Symbol
CDH17, CDH16, HPT-1, HPT1
Name
(RefSeq) cadherin 17
  KO
K06811  cadherin 17, LI cadherin
Organism
hsa  Homo sapiens (human)
Pathway
hsa05226  Gastric cancer
Network
nt06240  Transcription
nt06261  Gastric cancer
  Element
N00250  CDX2-overexpression to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09162 Cancer: specific types
   05226 Gastric cancer
    1015 (CDH17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    1015 (CDH17)
Cell adhesion molecules [BR:hsa04515]
 Cadherins
  Major cadherins
   1015 (CDH17)
SSDB
Motif
Pfam: Cadherin Cadherin_3 Cadherin_4 RET_CLD1 RibLong SKG6
Other DBs
NCBI-GeneID: 1015
NCBI-ProteinID: NP_001138135
OMIM: 603017
HGNC: 1756
Ensembl: ENSG00000079112
Vega: OTTHUMG00000164391
Pharos: Q12864(Tbio)
UniProt: Q12864
Structure
LinkDB
Position
8:complement(94127162..94217278)
AA seq 832 aa
MILQAHLHSLCLLMLYLATGYGQEGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTF
ELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIKVKDIN
DNRPTFLQSKYEGSVRQNSRPGKPFLYVNATDLDDPATPNGQLYYQIVIQLPMINNVMYF
QINNKTGAISLTREGSQELNPAKNPSYNLVISVKDMGGQSENSFSDTTSVDIIVTENIWK
APKPVEMVENSTDPHPIKITQVRWNDPGAQYSLVDKEKLPRFPFSIDQEGDIYVTQPLDR
EEKDAYVFYAVAKDEYGKPLSYPLEIHVKVKDINDNPPTCPSPVTVFEVQENERLGNSIG
TLTAHDRDEENTANSFLNYRIVEQTPKLPMDGLFLIQTYAGMLQLAKQSLKKQDTPQYNL
TIEVSDKDFKTLCFVQINVIDINDQIPIFEKSDYGNLTLAEDTNIGSTILTIQATDADEP
FTGSSKILYHIIKGDSEGRLGVDTDPHTNTGYVIIKKPLDFETAAVSNIVFKAENPEPLV
FGVKYNASSFAKFTLIVTDVNEAPQFSQHVFQAKVSEDVAIGTKVGNVTAKDPEGLDISY
SLRGDTRGWLKIDHVTGEIFSVAPLDREAGSPYRVQVVATEVGGSSLSSVSEFHLILMDV
NDNPPRLAKDYTGLFFCHPLSAPGSLIFEATDDDQHLFRGPHFTFSLGSGSLQNDWEVSK
INGTHARLSTRHTEFEEREYVVLIRINDGGRPPLEGIVSLPVTFCSCVEGSCFRPAGHQT
GIPTVGMAVGILLTTLLVIGIILAVVFIRIKKDKGKDNVESAQASEVKPLRS
NT seq 2499 nt   +upstreamnt  +downstreamnt
atgatacttcaggcccatcttcactccctgtgtcttcttatgctttatttggcaactgga
tatggccaagaggggaagtttagtggacccctgaaacccatgacattttctatttatgaa
ggccaagaaccgagtcaaattatattccagtttaaggccaatcctcctgctgtgactttt
gaactaactggggagacagacaacatatttgtgatagaacgggagggacttctgtattac
aacagagccttggacagggaaacaagatctactcacaatctccaggttgcagccctggac
gctaatggaattatagtggagggtccagtccctatcaccataaaagtgaaggacatcaac
gacaatcgacccacgtttctccagtcaaagtacgaaggctcagtaaggcagaactctcgc
ccaggaaagcccttcttgtatgtcaatgccacagacctggatgatccggccactcccaat
ggccagctttattaccagattgtcatccagcttcccatgatcaacaatgtcatgtacttt
cagatcaacaacaaaacgggagccatctctcttacccgagagggatctcaggaattgaat
cctgctaagaatccttcctataatctggtgatctcagtgaaggacatgggaggccagagt
gagaattccttcagtgataccacatctgtggatatcatagtgacagagaatatttggaaa
gcaccaaaacctgtggagatggtggaaaactcaactgatcctcaccccatcaaaatcact
caggtgcggtggaatgatcccggtgcacaatattccttagttgacaaagagaagctgcca
agattcccattttcaattgaccaggaaggagatatttacgtgactcagcccttggaccga
gaagaaaaggatgcatatgttttttatgcagttgcaaaggatgagtacggaaaaccactt
tcatatccgctggaaattcatgtaaaagttaaagatattaatgataatccacctacatgt
ccgtcaccagtaaccgtatttgaggtccaggagaatgaacgactgggtaacagtatcggg
acccttactgcacatgacagggatgaagaaaatactgccaacagttttctaaactacagg
attgtggagcaaactcccaaacttcccatggatggactcttcctaatccaaacctatgct
ggaatgttacagttagctaaacagtccttgaagaagcaagatactcctcagtacaactta
acgatagaggtgtctgacaaagatttcaagaccctttgttttgtgcaaatcaacgttatt
gatatcaatgatcagatccccatctttgaaaaatcagattatggaaacctgactcttgct
gaagacacaaacattgggtccaccatcttaaccatccaggccactgatgctgatgagcca
tttactgggagttctaaaattctgtatcatatcataaagggagacagtgagggacgcctg
ggggttgacacagatccccataccaacaccggatatgtcataattaaaaagcctcttgat
tttgaaacagcagctgtttccaacattgtgttcaaagcagaaaatcctgagcctctagtg
tttggtgtgaagtacaatgcaagttcttttgccaagttcacgcttattgtgacagatgtg
aatgaagcacctcaattttcccaacacgtattccaagcgaaagtcagtgaggatgtagct
ataggcactaaagtgggcaatgtgactgccaaggatccagaaggtctggacataagctat
tcactgaggggagacacaagaggttggcttaaaattgaccacgtgactggtgagatcttt
agtgtggctccattggacagagaagccggaagtccatatcgggtacaagtggtggccaca
gaagtaggggggtcttccttgagctctgtgtcagagttccacctgatccttatggatgtg
aatgacaaccctcccaggctagccaaggactacacgggcttgttcttctgccatcccctc
agtgcacctggaagtctcattttcgaggctactgatgatgatcagcacttatttcggggt
ccccattttacattttccctcggcagtggaagcttacaaaacgactgggaagtttccaaa
atcaatggtactcatgcccgactgtctaccaggcacacagagtttgaggagagggagtat
gtcgtcttgatccgcatcaatgatgggggtcggccacccttggaaggcattgtttcttta
ccagttacattctgcagttgtgtggaaggaagttgtttccggccagcaggtcaccagact
gggatacccactgtgggcatggcagttggtatactgctgaccacccttctggtgattggt
ataattttagcagttgtgtttatccgcataaagaaggataaaggcaaagataatgttgaa
agtgctcaagcatctgaagtcaaacctctgagaagctga

DBGET integrated database retrieval system