KEGG   Homo sapiens (human): 10220
Entry
10220             CDS       T01001                                 
Symbol
GDF11, BMP-11, BMP11, VHO
Name
(RefSeq) growth differentiation factor 11
  KO
K22679  growth differentiation factor 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    10220 (GDF11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    10220 (GDF11)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   10220 (GDF11)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 10220
NCBI-ProteinID: NP_005802
OMIM: 603936
HGNC: 4216
Ensembl: ENSG00000135414
Pharos: O95390(Tbio)
UniProt: O95390 A0A024RB20
Structure
LinkDB
Position
12:55743122..55757264
AA seq 407 aa
MVLAAPLLLGFLLLALELRPRGEAAEGPAAAAAAAAAAAAAGVGGERSSRPAPSVAPEPD
GCPVCVWRQHSRELRLESIKSQILSKLRLKEAPNISREVVKQLLPKAPPLQQILDLHDFQ
GDALQPEDFLEEDEYHATTETVISMAQETDPAVQTDGSPLCCHFHFSPKVMFTKVLKAQL
WVYLRPVPRPATVYLQILRLKPLTGEGTAGGGGGGRRHIRIRSLKIELHSRSGHWQSIDF
KQVLHSWFRQPQSNWGIEINAFDPSGTDLAVTSLGPGAEGLHPFMELRVLENTKRSRRNL
GLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQ
QANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS
NT seq 1224 nt   +upstreamnt  +downstreamnt
atggtgctcgcggccccgctgctgctgggcttcctgctcctcgccctggagctgcggccc
cggggggaggcggccgagggccccgcggcggcggcggcggcggcggcggcggcggcagcg
gcgggggtcgggggggagcgctccagccggccagccccgtccgtggcgcccgagccggac
ggctgccccgtgtgcgtttggcggcagcacagccgcgagctgcgcctagagagcatcaag
tcgcagatcttgagcaaactgcggctcaaggaggcgcccaacatcagccgcgaggtggtg
aagcagctgctgcccaaggcgccgccgctgcagcagatcctggacctacacgacttccag
ggcgacgcgctgcagcccgaggacttcctggaggaggacgagtaccacgccaccaccgag
accgtcattagcatggcccaggagacggacccagcagtacagacagatggcagccctctc
tgctgccattttcacttcagccccaaggtgatgttcacaaaggtactgaaggcccagctg
tgggtgtacctacggcctgtaccccgcccagccacagtctacctgcagatcttgcgacta
aaacccctaactggggaagggaccgcagggggagggggcggaggccggcgtcacatccgt
atccgctcactgaagattgagctgcactcacgctcaggccattggcagagcatcgacttc
aagcaagtgctacacagctggttccgccagccacagagcaactggggcatcgagatcaac
gcctttgatcccagtggcacagacctggctgtcacctccctggggccgggagccgagggg
ctgcatccattcatggagcttcgagtcctagagaacacaaaacgttcccggcggaacctg
ggtctggactgcgacgagcactcaagcgagtcccgctgctgccgatatcccctcacagtg
gactttgaggctttcggctgggactggatcatcgcacctaagcgctacaaggccaactac
tgctccggccagtgcgagtacatgttcatgcaaaaatatccgcatacccatttggtgcag
caggccaatccaagaggctctgctgggccctgttgtacccccaccaagatgtccccaatc
aacatgctctacttcaatgacaagcagcagattatctacggcaagatccctggcatggtg
gtggatcgctgtggctgctcttaa

DBGET integrated database retrieval system