KEGG   Homo sapiens (human): 10269
Entry
10269             CDS       T01001                                 
Symbol
ZMPSTE24, FACE-1, FACE1, HGPS, PRO1, RSDM1, STE24, Ste24p
Name
(RefSeq) zinc metallopeptidase STE24
  KO
K06013  STE24 endopeptidase [EC:3.4.24.84]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00900  Terpenoid backbone biosynthesis
Disease
H00663  Restrictive dermopathy
H00665  Mandibuloacral dysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    10269 (ZMPSTE24)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    10269 (ZMPSTE24)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10269 (ZMPSTE24)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.84  Ste24 endopeptidase
     10269 (ZMPSTE24)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M48: Ste24 endopeptidase family
   10269 (ZMPSTE24)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   10269 (ZMPSTE24)
SSDB
Motif
Pfam: Peptidase_M48 Peptidase_M48_N
Other DBs
NCBI-GeneID: 10269
NCBI-ProteinID: NP_005848
OMIM: 606480
HGNC: 12877
Ensembl: ENSG00000084073
Pharos: O75844(Tbio)
UniProt: O75844
Structure
LinkDB
Position
1:40258236..40294180
AA seq 475 aa
MGMWASLDALWEMPAEKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMD
SETFEKSRLYQLDKSTFSFWSGLYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEI
TQSLVFLLLATLFSALTGLPWSLYNTFVIEEKHGFNQQTLGFFMKDAIKKFVVTQCILLP
VSSLLLYIIKIGGDYFFIYAWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGKLKEEIEV
MAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVLNKDIQEDSGM
EPRNEEEGNSEEIKAKVKNKKQGCKNEEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCF
FLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADA
FAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMWHYSHPPLLERLQALKTMKQH
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggggatgtgggcatcgctggacgctttgtgggagatgccggccgagaagcgtatcttc
ggggccgtgctgctcttttcctggacagtgtatctttgggagaccttcctagcacagcgg
cagagaaggatatataaaacaacaactcatgtaccaccggagttaggacagatcatggat
tctgaaacatttgagaaatctcgactctatcaactggataaaagcactttcagcttctgg
tcaggactctattcagagactgaaggcactcttattcttctctttggaggaataccttat
ctctggagactttctggacggttctgtggttatgctggctttggaccagaatatgagatc
actcagtccctggtgtttctgctgttggctacacttttcagtgcattgactggtttgcca
tggagtctttataatacttttgtgatagaagaaaaacatggcttcaatcaacagactttg
gggttcttcatgaaagatgcaatcaagaaatttgttgtgactcagtgtattttgttgcct
gtgtcttcacttctactttacattattaaaattgggggtgactatttttttatttatgcc
tggctgttcacattagttgtgtctctggttcttgtcacaatctatgctgattatattgcc
cctttatttgacaaattcacacctctgcctgagggaaagcttaaagaagaaattgaagta
atggcaaagagtattgactttcctttgacgaaggtgtatgttgtggaaggatctaaacgc
tcttcccacagcaatgcttatttttatggcttcttcaagaacaagcgaatagttttgttt
gacactctactagaagagtactctgtactaaacaaagacatccaggaggattctggcatg
gaaccccgcaatgaggaagaagggaacagtgaagaaataaaagctaaagttaaaaataag
aaacaaggatgtaaaaatgaggaggtactcgctgtactaggccatgaactggggcactgg
aagttgggacatacagtcaaaaatatcattattagccagatgaattctttcctgtgtttt
tttttatttgctgtattaattggtcgaaaggagctttttgctgcatttggtttttatgat
agccaacccactcttattggactattgatcatcttccagtttattttttcaccttacaat
gaggttctttctttttgcctaacagtcctaagccgcagatttgagtttcaagctgatgca
tttgccaagaaacttgggaaggctaaagacttatattctgctttaatcaaacttaacaaa
gataacttgggattccctgtttctgactggttgttctcaatgtggcattattctcatcct
ccactgctagagagacttcaagctttgaaaactatgaagcaacactga

DBGET integrated database retrieval system